(data stored in ACNUC7421 zone)

EMBL: CP001402.PE165

CP001402.PE165       Location/Qualifiers
FT   CDS_pept        141988..142527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40801"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK60"
FT                   /protein_id="ACR40801.1"
FT                   /translation="MKILVMSNIRFPEPHVESMLSSIIKKEEPEVIVLNGDTTQCYWDY
FT                   ECPRVIDVLYVIRSIAPWAQIIYVQGDMDPHAIKCITAEPRYREEIIGTTMYIAEAASV
FT                   KYHIIHGHQGEIDQLRKSIGAGPWDWLVIGQYKRLEIDKLARVLYSGGITREFPPEARG
FT                   YVVITDSNFYIRNLRT"
     atgaagatat tagtaatgag caatattaga ttccccgaac ctcatgttga aagtatgtta        60
     tcaagtatta taaagaagga ggagccagaa gttatagtat taaatggtga tactacccaa       120
     tgctattggg actatgagtg tcctagagtc attgatgtgc tctacgttat taggagtata       180
     gctccctggg ctcagataat atacgtccaa ggagatatgg atcctcatgc aataaaatgt       240
     ataactgcag aacccagata tagggaggaa ataattggta caactatgta tattgcggaa       300
     gcagcctctg tcaaatacca cattattcat ggacaccagg gagaaataga tcagttgagg       360
     aagagtattg gggctggacc atgggattgg ctagtaatag gacaatataa gaggttagaa       420
     atcgataaac tagcaagagt attatatagt ggtggtataa ctagggaatt tccgccagaa       480
     gcaagaggtt atgtagttat cactgactca aatttttaca ttaggaatct cagaacctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page