(data stored in ACNUC7421 zone)

EMBL: CP001402.PE167

CP001402.PE167       Location/Qualifiers
FT   CDS_pept        142854..143237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40803"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK62"
FT                   /protein_id="ACR40803.1"
FT                   /translation="MQLENKPIVVISSTNAEEIPNFIRAMFKDCRLNGSKKLIINFISS
FT                   ISYPEFIQNAREALLDNIDLGAYIYIWKPEEVDQMMKKILENRQDMKGIIIYCDDNNKY
FT                   TIEKILHKVPNSIKANIIKDYCK"
     atgcaacttg aaaataagcc aattgtagtg atctcttcaa ccaacgctga ggaaataccg        60
     aatttcatta gggcgatgtt taaggattgc aggttaaatg ggagtaagaa attaataata       120
     aatttcattt catcaatttc ttacccagag tttatacaaa acgccagaga ggccctttta       180
     gataatatag atttaggtgc gtatatttac atttggaaac ccgaagaggt tgaccaaatg       240
     atgaaaaaga tcttggaaaa tcgtcaagat atgaaaggta taataatata ttgtgatgat       300
     aataataaat atacgattga aaaaatactt cataaagttc ctaattcgat aaaggcaaat       360
     attataaagg attattgtaa ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page