(data stored in ACNUC7421 zone)

EMBL: CP001402.PE169

CP001402.PE169       Location/Qualifiers
FT   CDS_pept        complement(144609..146225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40805"
FT                   /db_xref="GOA:C4KK64"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK64"
FT                   /protein_id="ACR40805.1"
FT                   /translation="MGMDTENLTRKYYGYLKTLPNIKIFATTFSAESLFIMLRSFQLTF
FT                   DYLFSFALYSILLTIIFKNKIKLALFLMNLTAIPYLLLSLLPIAPFYAFGFFMPLMAYI
FT                   LLSSYKEIPSIVLSGITSYVPIIFYVKYSIIFLIYIIIIGLIFHFYIYTVNRKGVKILG
FT                   FKSTQVAVPFITAITEKNKVPLENFLNLVSVKTNLSVFMYKLDDFLFMIPQIHFGVFDS
FT                   VGSSRFVYDIEKTLRNNVVTVFHGPGSHELDLPSSAEVNKVMEAISKSTLERSNWYKAT
FT                   FYGISIEKRSTFDITSLEFDKFRVSFMERPEFGIDDLPSSLWKYMLSSNNYLIDCHNSF
FT                   LVKEYDNHEINSLKEFIMDQRGIKSTRKLLVGYAEGKLAKTCEGLCDSRIRVFTFDDRV
FT                   KRVSIVYIYANNSTKELNNAISSAVRQIVDKVILVTPDDHSCTGISLGITYSPATFCED
FT                   IVNKASELIKRSTENMKEINSIEYKVVKIKGVKILGKIISIMLKALEDVGSYTSKTFWI
FT                   PLVAPYVLLVVILLFQSLIKF"
     atgggcatgg atactgaaaa cttaacaagg aaatactatg gttatcttaa aactctgcca        60
     aatataaaaa tatttgcaac aaccttttca gcagaatcct tatttataat gctaaggagt       120
     ttccaactaa ctttcgatta tctattttca tttgcactct actcaattct tctaacgata       180
     atttttaaga ataagataaa attagcctta tttcttatga atctaactgc gataccttac       240
     cttcttcttt ctctgttacc tatagctcca ttttacgcat ttggattttt catgccgcta       300
     atggcgtata ttctcctaag tagttataag gaaatccctt ccatagtgct atctggaatt       360
     acatcgtatg tccctataat attttacgtt aaatactcaa ttatctttct aatctatata       420
     attataatag gtttaatatt ccatttttat atatatacag ttaatagaaa gggcgtaaaa       480
     atacttgggt tcaagtcaac gcaagtagct gttcccttca taacagcaat aactgaaaaa       540
     aataaagtac ctctagaaaa ttttctaaat ttagtatctg taaaaactaa tctgagtgta       600
     tttatgtaca aattggacga ttttcttttc atgataccac aaatacattt cggagttttc       660
     gatagtgttg gtagttctag attcgtttat gatattgaaa aaaccttaag aaataacgta       720
     gtaacggtat ttcatggacc aggtagccat gaattagatt taccctcatc tgccgaggta       780
     aataaagtaa tggaagcaat ctcgaaaagt acgctagaac gtagtaattg gtataaggcc       840
     actttttacg gcatttcaat cgaaaaacgc tctacttttg atattacatc attagaattc       900
     gataaattca gagtatcatt tatggagaga cctgagtttg gaatagatga tttaccatct       960
     tccctatgga agtatatgct atcctcaaat aactacctta tagattgcca taactctttt      1020
     ctagtaaaag aatacgataa tcacgaaata aatagtttaa aggaattcat catggatcaa      1080
     agagggatta aaagtacaag gaaacttttg gtaggatatg cagaaggaaa attagctaaa      1140
     acatgtgagg gattatgtga tagtcgtata cgagtcttca catttgatga tagagtaaag      1200
     agagtatcta tagtttacat ctacgctaat aactcaacta aagaacttaa taacgctata      1260
     tccagtgcag tcaggcaaat cgttgataag gtaattttag tcacaccaga tgatcactct      1320
     tgtactggga taagcctagg gattacatac tctccagcta ctttttgtga agatatcgtg      1380
     aataaagcat ctgaactaat taagagatcc acagagaata tgaaggagat aaatagcata      1440
     gaatataaag tggttaagat aaaaggtgta aagatcctcg gaaaaataat ttctattatg      1500
     ctaaaggcgc tagaggacgt agggagttat acttcaaaaa cgttttggat tcccttagta      1560
     gcaccatatg ttttacttgt agttatacta cttttccaaa gccttattaa attctaa         1617
//

If you have problems or comments...

PBIL Back to PBIL home page