(data stored in ACNUC7421 zone)

EMBL: CP001402.PE17

CP001402.PE17        Location/Qualifiers
FT   CDS_pept        complement(14721..16334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0017"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40653"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD3"
FT                   /protein_id="ACR40653.1"
FT                   /translation="MLMEKGEIIGIVLQKSEANELQGLIRADEEINIGQLLLIDDSEKL
FT                   SLVRVENYEFLNEFFDERGDIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHSTTPKP
FT                   GSFVRKLPEIKSEKDLLSFYGIKSKKGLIEYGALAGSEIPLLLDLNAITMHVGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDNITALPMIVIDANGDYIDLASTNLDIVSRGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHDSKEYN
FT                   TLLGTAIGIENLRNEILTMAQNKDIGITTSTARGIASALEIFKNKVISRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSAEGSPGIDVLTKQLIVSYITRLIFNYLTKSKYNGNQRFL
FT                   GFVIEEAQNYIPSVDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFFFHRIYHEDVRYVMSASGGLPESLTRNLTSLETGHVIVSGLMSIMKSPALVRIPWD
FT                   ARLGSYAGNVERIDLILSEG"
     atgttgatgg aaaagggaga gatcatagga atagtactgc agaaaagcga agcaaatgaa        60
     ttgcaagggc taattagagc tgacgaagaa ataaacatag ggcaattgtt attaattgat       120
     gattctgaga aactttcgct agtcagggtt gagaattatg aatttctgaa cgagttcttt       180
     gacgaaaggg gggatatagc taagtcaata ctaaaagaac catcgatata cgagattcta       240
     gatatgaata caataataaa ggctactttg cacttaataa aaaaatatga tcatagcact       300
     actcctaaac cgggttcttt cgtaagaaaa ctaccagaaa taaagagtga aaaagaccta       360
     ctttcgtttt atggtataaa aagcaagaaa ggattaattg agtacggtgc tttagcgggt       420
     tctgaaatac cattattatt agaccttaat gcgataacga tgcatgtagg agtttttggg       480
     gagacaggaa gtggaaaaag ctataatatg agatatttaa tcaagcttct atccaacata       540
     aaaataggag ataatatcac agccttaccg atgattgtaa ttgatgcgaa tggagactac       600
     atagatttag cttcgacaaa tctagacatc gtatctaggg gaaggggctg gataaaaagg       660
     tatatactaa aggatcctaa ggaacaaaat gacattaaac tcacaataga tttgtccata       720
     ttcactccta gagaattatc agaattcatt atgtctctaa aatacggaga agcttcctat       780
     aacaccttgc aactaaattt cctagagcaa gtactagcaa atcacgatag taaggagtac       840
     aatacccttc taggaactgc aataggaatt gagaacctaa gaaatgagat ccttactatg       900
     gctcaaaata aagatatagg aataacaaca agcacggcta gaggaattgc gagtgcacta       960
     gaaatattca aaaacaaggt gattagcaga ctacaactgg tcaactcttc tgcatcttta      1020
     actgaaaata cactagaagt gatttggagg aatagaggtt tagcaataat agacttctct      1080
     gctgagggat caccaggtat agacgtcctt acaaaacagc ttatcgtgag ttacataacc      1140
     agattgatct tcaattatct cacaaaatcc aaatataacg gcaatcaaag gttcttggga      1200
     tttgtaatag aagaggcaca aaactacata ccttctgttg attatccagt aaacgccaac      1260
     ttgacaaaag acgtattggt aacgttggca acccaaggaa gaaaatttgg agcttcttta      1320
     attctcgtaa gtcaaagacc ggcatttata gataaatacg tattgtcgat gattaacacc      1380
     ttcttctttc atagaatata tcacgaagat gtaaggtatg tgatgtctgc ttcgggaggt      1440
     ttaccagaat cgttgactag gaatttgaca tcattagaga ctggacacgt aatagtaagt      1500
     gggcttatgt caataatgaa aagtccagca ttggtaagaa taccgtggga tgctaggttg      1560
     ggatcatacg ctggaaacgt ggaaagaatt gatttaattt taagcgaagg gtga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page