(data stored in ACNUC7421 zone)

EMBL: CP001402.PE170

CP001402.PE170       Location/Qualifiers
FT   CDS_pept        146256..146546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40806"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK65"
FT                   /protein_id="ACR40806.1"
FT                   /translation="MSINKEKLGVDKVIRNSLDYCDLYIIQKGDKVFLLYLFEREKYYY
FT                   FKIMPEIIGKWEDCENVLYTAIGLFGFVNKQDELEQKIREKMEALIKNVNT"
     ttgtcaatca ataaggaaaa gttaggtgta gacaaagtta taagaaattc gttagattat        60
     tgtgacctat atatcataca aaaaggtgac aaagtgtttc ttctatatct atttgagaga       120
     gaaaaatact attatttcaa aataatgccg gagataattg ggaaatggga agattgtgaa       180
     aacgtactct atactgcaat cgggcttttt ggctttgtga ataaacaaga tgaattggaa       240
     caaaaaatta gagaaaagat ggaggcgtta atcaaaaatg tcaacactta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page