(data stored in ACNUC7421 zone)

EMBL: CP001402.PE172

CP001402.PE172       Location/Qualifiers
FT   CDS_pept        147375..149075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0174"
FT                   /product="succinate dehydrogenase or fumarate
FT                   reductase,flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40808"
FT                   /db_xref="GOA:C4KK67"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK67"
FT                   /protein_id="ACR40808.1"
FT                   /translation="MEKIEYDAVVIGGGLAGLMSAHEIASAGFKVAVISKVFPTRSHSA
FT                   AAEGGIAAYIPGNSDPNDNPDYMTYDTVKGGDYLVDQDAAELLSNKSGEIVMLLERWGA
FT                   LFNRQPDGRVAVRYFGGQTYPRTRFVGDKTGMALLHTLFERTSGLNVDFYNEWFSLDLV
FT                   TDNKKVVGIVAMQMKTLTPFFFKTKAVVLATGGMGMLYRHTTNSYINTGDGFGIALRAG
FT                   AALKDPEFVQFHPTALYPSDVLISEAARGEGGILKNVKGERFMTKYAPKKLDLAPRDIV
FT                   SRAIITEIREGRGFPGGYVGLDLTHLGEEYIKERLALAVEAAKSFASVDAFTEPIPVRP
FT                   AQHYYMGGIDVDIDGRNPDIVGLFSAGEAACVSVHGANRLGSNSLLDTLVFGQVTGRTV
FT                   VQFLKSNPGNPTSNYEKEAEKVVDDAYKFVKSESGVHFGQILEKLRDTMWDYVGIYRDE
FT                   GGLLNAMSEINKLRGMISNMYVTDKSKVYNTEFFNALELRNMLDLALTITKSALERKES
FT                   RGAHYRTDYPDRDDNNWLKHTIAYLRGNTVEVTFKPVKITRWKPEPRVY"
     atggaaaaga tcgaatacga tgcagttgta attggaggag gactagctgg cttaatgagt        60
     gcgcacgaga tagcctctgc tggctttaaa gttgctgtta tttcaaaggt gtttcccaca       120
     aggtcacact ctgctgctgc agaaggtgga atagctgcct acattcccgg caattcagat       180
     ccaaatgata acccagatta tatgacatat gatacagtta aaggaggaga ttatttagta       240
     gatcaagacg cggcagagtt actttctaac aaatccggag aaatagtaat gctactggaa       300
     agatgggggg ctctattcaa taggcaacct gatggcagag tcgcagttag atattttgga       360
     ggacagacct atccgaggac tagatttgtg ggagataaaa caggtatggc gcttttgcat       420
     acgctttttg aaaggacttc cggtctaaat gtggattttt acaacgagtg gttctcctta       480
     gacttagtta ctgataataa aaaggtagtt ggtatagtag caatgcaaat gaagacgctg       540
     actccattct tctttaagac aaaggctgtc gtattggcaa ctggaggaat ggggatgctg       600
     tataggcata caaccaatag ttacattaac actggtgatg gcttcggaat tgcattaaga       660
     gcgggagctg cgttaaaaga tccagaattt gtgcaatttc atcccacagc attataccca       720
     tcagacgttc ttattagtga agccgctaga ggagaaggtg ggatactgaa aaatgttaaa       780
     ggagaaagat ttatgacgaa atatgctccc aaaaagctag atctagcgcc tagggatata       840
     gtttcaagag caatcatcac cgagataagg gaaggaagag ggttccctgg tggatatgtt       900
     ggcttagatt tgactcattt aggtgaagaa tatattaaag aaaggttagc tttagctgta       960
     gaagctgcaa aaagttttgc aagtgttgat gcgtttactg agcctattcc agtcaggccc      1020
     gctcagcatt attatatggg aggaatagat gtggatatag atgggaggaa tccggatatt      1080
     gtgggattat tctctgcagg tgaagcagct tgtgtatcag tacatggggc taatagatta      1140
     ggctcaaatt cacttctgga cactttagta tttggccaag ttacaggtag aactgttgta      1200
     caatttctta agtctaatcc aggtaacccc acatcaaatt atgagaaaga ggctgagaaa      1260
     gttgttgatg acgcttacaa gttcgtaaag agcgagagtg gtgtacattt tggccaaata      1320
     ttagaaaagc taagagatac aatgtgggat tatgttggaa tatatagaga tgagggtggt      1380
     ctactaaatg caatgtccga gataaataaa ttaagaggta tgattagtaa tatgtatgtt      1440
     acagataaga gtaaagtcta taatacagaa ttctttaacg ctcttgaatt aaggaatatg      1500
     ttagatttag cattaactat aaccaagtca gctttagaga ggaaagagtc aagaggggct      1560
     cattatagga cggattatcc agatagagat gataataatt ggttgaaaca cacgattgcg      1620
     tatttaaggg gtaatacggt tgaagtcaca tttaaaccag ttaaaataac cagatggaag      1680
     ccagaaccta gggtgtatta a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page