(data stored in ACNUC7421 zone)

EMBL: CP001402.PE173

CP001402.PE173       Location/Qualifiers
FT   CDS_pept        149077..150027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0175"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40809"
FT                   /db_xref="GOA:C4KK68"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK68"
FT                   /protein_id="ACR40809.1"
FT                   /translation="MTQSQEEEVILKVKRFNPERGFWWAEYKLKVDRFTQFTEALRRIK
FT                   SEQDPTLSYRASCHMAVCGSCGMKINGEPRLACKTLVLDVAKKYNSHVITIEPMDYFKP
FT                   IKDLIVDWDEFYERMFKVKPRLYQAKEVLEGKAEHRLKPEDQKELWKFAQCIWCGLCVS
FT                   ACPAVIIDQQFLGPAAHAKGYRFLADPRDTITEERMKILIDSSWRCTYCYQCFNVCPRD
FT                   IEPVTAIKKTRSFTRMYKAKSEVAERGENHVEAIRESIFKTGKLSEAPVYLKTYGVLQS
FT                   LIDLVYMSRAGKLKYILVQEKPVQNINEIKKIIGE"
     atgactcagt ctcaagagga agaagttata ttaaaggtaa agagattcaa tcccgaaaga        60
     ggattctggt gggcagaata taagctgaag gttgataggt ttacacaatt tacggaggcc       120
     cttaggagaa taaagagtga acaagatcct acactatcgt acagagcatc ttgtcatatg       180
     gcagtatgtg gaagttgtgg aatgaaaatt aatggtgaac ctagactggc ctgtaaaacg       240
     ctagttttag atgtcgccaa aaaatataac agccatgtga taacaattga gccaatggat       300
     tattttaaac caatcaaaga cttaatagtg gactgggatg agttttacga aaggatgttc       360
     aaggtaaaac caagattata tcaggctaaa gaggtattag agggtaaagc tgaacataga       420
     cttaaacccg aagatcagaa agagttatgg aaattcgctc aatgcatatg gtgtggatta       480
     tgtgtatcag cttgtccagc ggttataata gatcagcaat ttttaggacc agctgctcat       540
     gctaaaggtt ataggttttt agctgatcca agggatacaa taaccgaaga gagaatgaaa       600
     atattaattg atagttcatg gcgttgtact tattgctatc aatgctttaa tgtgtgtcca       660
     agagatatag agccagtgac tgcaataaag aaaactagaa gctttactag aatgtacaag       720
     gccaaatcag aagtagcaga aagaggcgaa aatcatgttg aggctattcg tgaatctata       780
     tttaaaactg gaaagctctc tgaagcacca gtatatttaa agacctacgg agtgttgcaa       840
     tcccttattg atctagtgta tatgtcgagg gcaggaaagc ttaagtacat attagttcaa       900
     gagaaacccg tacaaaatat aaacgaaatt aaaaagataa taggtgagtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page