(data stored in ACNUC7421 zone)

EMBL: CP001402.PE179

CP001402.PE179       Location/Qualifiers
FT   CDS_pept        154737..155018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40815"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK74"
FT                   /protein_id="ACR40815.1"
FT                   /translation="MNFEDVKDKKPKKIGELIDRSEENENYIVKVAEDKVYELAPIAYY
FT                   IWTMCDGNKSVDEIVNELSKEANLDISQVRDPVVMVLDELEKASLIAF"
     gtgaattttg aagatgtaaa agacaaaaaa ccaaagaaaa taggagaatt aatcgataga        60
     agtgaagaga atgaaaatta tatagtaaaa gtagctgaag ataaagtata tgagcttgct       120
     ccaatagctt attatatttg gactatgtgt gatggtaata aaagcgtgga tgagatagtt       180
     aatgaattaa gtaaagaggc aaatttagat atatcgcaag ttcgtgatcc cgtagtaatg       240
     gtattagacg agttagaaaa ggcgtctctc atagcttttt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page