(data stored in ACNUC7421 zone)

EMBL: CP001402.PE18

CP001402.PE18        Location/Qualifiers
FT   CDS_pept        complement(16379..16945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40654"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD4"
FT                   /protein_id="ACR40654.1"
FT                   /translation="MSSACERLYEYLKPDFTRISKKDNTDDLFRHPVVMRWHHYFLENW
FT                   NSDKEIGLLLPCTVVKPYSLSPTHKIAYATLNKYNLEEKVQVYSVSEPMLLVPKELEEC
FT                   YPFNNYDYPPRLMSKEEKEEFIMLLTKPLIKVSMLHNRLIGILPRHHYEIVKRAAEISN
FT                   LKITIYPYGRLAFKTIANVITSISS"
     atgagctctg catgcgagcg actatatgaa tatctaaagc ctgattttac tagaatatct        60
     aaaaaagata atacggatga tttattcaga cacccagtag taatgagatg gcatcactat       120
     ttcctggaaa attggaattc ggacaaggaa attggattgc tattgccttg tacagtagtt       180
     aagccttatt cattatcgcc aacccacaaa atagcctatg ctacattaaa caaatataat       240
     ttagaagaaa aagtacaagt ctattcagta tcggaaccaa tgcttttagt gcctaaagaa       300
     ttagaggaat gctatccttt taataattat gattacccgc cgagacttat gagtaaagag       360
     gagaaagaag agtttataat gttattaacg aaacccctca taaaagtaag tatgctacac       420
     aataggttaa taggtatact acctaggcat cactacgaaa tagtcaaaag ggcagctgaa       480
     atctcaaatt taaaaataac aatttaccca tatggtagat tagcctttaa aaccatagct       540
     aatgtgataa caagcatttc atcataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page