(data stored in ACNUC7421 zone)

EMBL: CP001402.PE184

CP001402.PE184       Location/Qualifiers
FT   CDS_pept        complement(159361..159900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40820"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK79"
FT                   /protein_id="ACR40820.1"
FT                   /translation="MSTEIDSKNVSMDMFTTYEEELRVGEALAHILAAASIVIELEGES
FT                   EEVRNTIMKYVDLWISKLSPIDYSPGMAEVIGSKVRKKITNIFDEISENELGDILDFII
FT                   DVKRKLDIGTLETEILELEVRVERVLRVLGIDINDIRQFFDFTNVEKRANRLIALATVS
FT                   IGIASVWDEKWTAELQ"
     ttgagcacgg aaattgatag taaaaacgta tcaatggaca tgtttacgac ttatgaggag        60
     gagttaagag taggagaggc attggctcac atactggcag ctgcatctat agtaatcgaa       120
     ttggaagggg agagcgagga agtgagaaat accataatga aatacgtcga tctttggatt       180
     tctaaattat caccaattga ctactctccg ggaatggctg aagtgatagg ttctaaggtt       240
     agaaagaaaa taacaaacat ctttgatgaa ataagtgaaa atgaattagg agatatatta       300
     gatttcatca tagatgttaa gagaaaacta gatattggca cattagaaac tgaaatatta       360
     gagttggaag ttagagtgga aagagttctt agggtgttgg gaatagatat aaatgatata       420
     aggcaattct ttgattttac taatgtagag aaaagggcta atagactaat agcattggct       480
     acagtatcaa taggtattgc atcagtatgg gatgaaaaat ggacagcgga attacaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page