(data stored in ACNUC7421 zone)

EMBL: CP001402.PE185

CP001402.PE185       Location/Qualifiers
FT   CDS_pept        160038..161045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0187"
FT                   /product="protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40821"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK80"
FT                   /protein_id="ACR40821.1"
FT                   /translation="MKAFVFGIGGGGDIVSAIVAYTYLRKLGYNVLLGAVVWERYVEDP
FT                   IPGPICFDDLRNAILVNQGLYKVNKDTYAIRGSRQVVPQLVRAIRALELDGAYGICNKS
FT                   GAMGLYSSLKEFVNTEKIDLIVGVDAGGDVLAKGCEETLGSPLIDFISLASLVKLEEDG
FT                   YNVMLGVIGSGSDGELQYDYFLKRISEIASLNGLLDIKGYDRETATLVERVLNEVNTEA
FT                   SKIPFEAFKGLYGEIPIRNGTRNVFVTPVSAIMFFLDPIKVAETSPLYSLVKDSSSIDD
FT                   ANKNLNEVGIYTEYNFEIDLYSQFGLNASHASAYDVSKIRAEGRRKLGGVKIKC"
     atgaaagcat ttgttttcgg gataggcggt ggaggcgaca tagtatctgc gatagtggca        60
     tatacttact tgagaaagtt aggctataat gttttgctag gtgcagtggt ttgggagaga       120
     tatgtagaag atcccatacc gggacccata tgttttgacg atttaagaaa cgctattcta       180
     gtaaaccaag gtttatacaa ggttaataaa gatacttatg cgatcagagg cagtaggcaa       240
     gtagtacctc aattagtaag ggcaattagg gcattagaat tggatggagc ttacggaatt       300
     tgcaataaaa gtggagccat gggtctttat tcatcattaa aggaatttgt aaatacagag       360
     aaaattgatc taatagttgg agtagatgca ggaggcgacg tattagctaa gggttgtgag       420
     gaaaccttgg gtagtccact cattgatttt atctctttag cctctcttgt caagctagag       480
     gaagatggat ataatgttat gttaggagtt ataggtagtg gtagtgatgg agaattacaa       540
     tacgattact ttcttaagcg aattagtgaa atagcttcgt tgaacggttt actggatatt       600
     aaaggttatg atagggaaac agcaactcta gtagagagag tcctaaatga agttaatact       660
     gaagcatcaa agataccttt tgaagcattt aaggggttgt atggagagat acccattaga       720
     aatggtacaa gaaatgtttt cgttactcca gtctcagcta ttatgttctt tcttgatccc       780
     attaaggtag ccgagactag tcctctttat agcttagtta aggattcctc ttcaatcgat       840
     gacgctaaca agaatcttaa tgaagttggt atatacactg aatataactt tgaaatagat       900
     ttgtatagtc aatttggttt aaatgcttcc catgcttctg catatgacgt aagcaagatt       960
     agggcagaag gtaggaggaa attaggaggc gttaaaataa agtgctag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page