(data stored in ACNUC7421 zone)

EMBL: CP001402.PE186

CP001402.PE186       Location/Qualifiers
FT   CDS_pept        161076..161618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK81"
FT                   /protein_id="ACR40822.1"
FT                   /translation="MDLIRELKSEYGFDEDEINYALSRARGIIFGFAMEYRARRILQEM
FT                   DFENIKSVDMPTHDIEAEKNGIKYYVEVKASKKSPTREYSAYKVAMIALLDGVHLTLSM
FT                   IPKPNLLLTEEILSEPKRILYRFFKLAYMKQSEELKVFLENEKNREVLDSYSNVIRTIS
FT                   NRYHLPIALDLVNPFSS"
     gtggatctga ttcgtgaact aaagtcagag tacggctttg atgaagatga aataaattac        60
     gcgttatcta gagctagagg cataatcttt ggctttgcca tggagtatag agctaggcga       120
     atattacaag aaatggattt tgaaaatatc aagtcagtcg atatgccgac tcatgatata       180
     gaagctgaaa agaatggtat taagtattat gtagaagtaa aagctagtaa aaaatctcct       240
     acaagggaat atagtgccta taaggtagcg atgatagcat tattagatgg ggttcatttg       300
     accttatcta tgatacctaa gccaaatctt cttttaactg aggaaattct tagtgaacca       360
     aaaagaatat tgtataggtt ctttaaattg gcttatatga aacaatcgga agagctgaaa       420
     gtatttttgg aaaatgagaa aaatagagaa gttttagatt cgtattctaa tgtgataagg       480
     actattagta atagatatca cttaccgatt gctcttgatc tcgttaatcc cttttcttcc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page