(data stored in ACNUC7421 zone)

EMBL: CP001402.PE187

CP001402.PE187       Location/Qualifiers
FT   CDS_pept        complement(161577..162146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0189"
FT                   /product="KH type 1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40823"
FT                   /db_xref="GOA:C4KK82"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK82"
FT                   /protein_id="ACR40823.1"
FT                   /translation="MRILFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPK
FT                   GQNQYEALKAVSVIRAIGLGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRI
FT                   IGEGGKAKRIIQEYTGVDISIYGHYIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLD
FT                   KAEKDLIIYKTSKLGRKGINEIKSNR"
     ttgagaatct tgttcactac ggtagaagat gagaaattag aagtagttaa aaaaatcatt        60
     gagaaacttg agcagtttac agatactaaa attatgtacg atgaaagaac taagactttc       120
     aatatacttc ctaagggtca aaatcaatat gaagccctca aggctgtctc agtaataaga       180
     gcaataggtc taggattcga tgagcaatcc gcctttagat tgcttagtga cgaatatatc       240
     ttagatgtga tagatttgaa aacactcata ggaagtaatc cagatgcaat aagaagagta       300
     aagggaagga taataggcga aggtggaaaa gctaaaagaa taattcaaga gtataccggg       360
     gttgatatat caatttacgg ccattatata ggaataatag gaccttatga tcaagttcaa       420
     atagcaagga aggcaataga gcttttgatt gatggaaaag aacattcctc agtctataaa       480
     tttctagata aagcagaaaa agatctgata atatacaaaa cctctaaatt aggaagaaaa       540
     gggattaacg agatcaagag caatcggtaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page