(data stored in ACNUC7421 zone)

EMBL: CP001402.PE188

CP001402.PE188       Location/Qualifiers
FT   CDS_pept        complement(162143..162907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0190"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40824"
FT                   /db_xref="GOA:C4KK83"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK83"
FT                   /protein_id="ACR40824.1"
FT                   /translation="MTELPKKTKDEKRRKDEDLFKVVDSTIDYRTYLNLIQIARRLNIE
FT                   EYLGAISSGKEARIYPAKTFDNKYYAVKIYYTSTAQSKRAIKKYTVGDIRFEDVKATNT
FT                   KQLINTWAKKEFKNLSRLYEAGTRVPKPILVYENILVMEFIGENGLRAPLLKELNDEEI
FT                   TQELYDDLIQQVEIMTKRAKLVHGDLSEYNVMVYDNKCYIIDVSQSIPIDYEDAIMLLK
FT                   RDLDNINRFFEDKGINIKPTEELLIEFGVSGD"
     ttgacggaat taccaaagaa gactaaagac gaaaaaagac gtaaagacga agatcttttt        60
     aaagtagtag attccacaat agattatagg acttatctaa atttaattca aatagctaga       120
     agattgaaca ttgaggagta tttgggtgca atatcgtctg ggaaagaagc taggatatat       180
     cctgcaaaga ctttcgataa taagtactat gcagtaaaga tatactacac atccacagcg       240
     caaagtaaaa gagccattaa aaaatatact gttggcgata taagatttga agacgtaaag       300
     gcaaccaata ctaaacaact tattaatact tgggcgaaaa aggaattcaa aaaccttagt       360
     agactatatg aggctggaac tagagtacca aaacctattc tggtttacga aaacattctt       420
     gtaatggaat ttattggtga aaatggccta agggctcccc ttttgaagga gttaaatgat       480
     gaagaaatta cgcaagaatt gtatgatgac ctaattcaac aagtggaaat tatgacgaaa       540
     agagctaaat tggttcacgg agacttaagt gagtataatg taatggttta tgataataaa       600
     tgctacataa ttgatgtgag ccaatcaatt cccatagatt acgaagatgc gattatgtta       660
     ttgaaaagag acctcgataa cataaataga ttttttgagg ataaaggaat aaatataaag       720
     cccacagaag agttattaat agaattcgga gtttccgggg attga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page