(data stored in ACNUC7421 zone)

EMBL: CP001402.PE19

CP001402.PE19        Location/Qualifiers
FT   CDS_pept        complement(16917..17801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40655"
FT                   /db_xref="GOA:C4KJD5"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD5"
FT                   /protein_id="ACR40655.1"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMVNQLNWNNLSWENETWVDSGGYQ
FT                   IMVKGIKVEIEKVVEKYKILDATQYMSLDIPSNPCHKPSELNYKYFEYLYAVFDKKIVP
FT                   VIHAYDVESIKKSIDFYSQYTDLVAFGGIIPPTLNKSGNKKLAVTIYHLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNANSVDTSTYRIKGIHGMVIIPGKGERYVGERKIVWGTRRASEEE
FT                   LETLLSFLDRTNYPFPIRLDNWVDRSLINAWVLLNSEYEINNPLIEYSKKLDSFPEDEI
FT                   EEEVNELCMRATI"
     atgaagataa tactaggtat acctgacttg aaaatcccag tttggacgtt taaacaacca        60
     ttaatggtta accaactaaa ctggaataat ctatcctggg aaaatgagac atgggtagac       120
     tctgggggat atcaaataat ggtaaaaggg ataaaggttg aaatagaaaa agtggttgag       180
     aaatataaaa ttttagatgc tacacaatac atgagcctcg atataccgtc aaacccttgt       240
     cataaacctt cagaattaaa ttacaaatac ttcgagtatc tgtacgcggt ttttgataag       300
     aaaatagtac cagttataca cgcttatgat gtagaatcaa taaagaagtc catagacttc       360
     tactcccaat atactgatct agtggcattc ggtggaatta tacctcctac cctcaataaa       420
     agtggaaaca aaaaactcgc agttacaata tatcatctag tgagaaaatt atggaaagga       480
     aaaattcacg tattgggagc tggatcacca ttcatgagaa aagtctactt taacgctaat       540
     agtgtagata cctcaaccta cagaatcaag ggaatacatg gcatggtaat tatacccggc       600
     aaaggagaaa gatatgttgg tgaaagaaaa atagtttggg gcactaggag agcgagtgaa       660
     gaggaattag agactttatt atcattctta gatagaacaa actatccgtt tccaatcaga       720
     cttgataatt gggtagatag aagtctaatt aatgcttggg tactcttaaa ttcagaatat       780
     gagattaaca atccattaat agagtattct aaaaagctag atagtttccc agaagatgag       840
     atagaggaag aggtaaatga gctctgcatg cgagcgacta tatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page