(data stored in ACNUC7421 zone)

EMBL: CP001402.PE191

CP001402.PE191       Location/Qualifiers
FT   CDS_pept        complement(164514..165779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0193"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40827"
FT                   /db_xref="GOA:C4KK86"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK86"
FT                   /protein_id="ACR40827.1"
FT                   /translation="MKTIYVETYGCALNRADTYVMMTLLKSEGYNFVENPENADIIILN
FT                   TCAVRLETEERMKQRIKELNTLSKKLVVAGCMSSAEPATVLSIAPNASLIGPQSVERII
FT                   DVIKSEERKIVLEGDRALITPRTFDGKIAIIPVADGCAGNCSFCITKLARRKLRSYPLR
FT                   EIVNAARDAVKAGAKEIELTGQDTAAYGLDLGGSISLVDVVNKVTEIDGDFMIRIGMMT
FT                   PEQAMRIIDNLIEVMRNPKVYKFIHLPVQSGDDRVLKLMNRKYTIDEYKELVSEIRSKI
FT                   PFANITTDIIIGHPGEDEDAFNNTLLLMKELRFERIHLAMYSIRPNTRSASMPQVPDSV
FT                   KKKRIQIANKLYEDIALSIHLEYVGSTSRVITTELGRKGSVVGRLMNYIPVVIRSENVE
FT                   LGKWYNVKITEASFYDLRGVFA"
     atgaaaacca tctacgttga gacatatggg tgtgcattaa atagggcaga tacttacgta        60
     atgatgacgt tgcttaaaag tgagggttat aattttgtag aaaaccctga gaacgcagat       120
     ataattatac tcaatacttg cgcagtaagg ttagaaactg aagagagaat gaaacaaaga       180
     attaaggaat taaacacgtt atcaaaaaaa ttagtggtag caggatgtat gagtagtgca       240
     gaaccagcta cagtactttc catagctcca aatgcgtcat taataggtcc acaatcagtt       300
     gaaagaataa tcgatgtaat taaatcagag gagcgtaaaa ttgtccttga gggcgataga       360
     gcacttataa ctcctagaac tttcgatgga aaaattgcaa taattccagt agctgatgga       420
     tgtgcaggaa attgcagctt ctgcataacc aaactagcaa ggaggaaatt gaggagctat       480
     ccattaaggg aaatagttaa tgctgcgaga gatgctgtaa aagctggtgc taaagaaata       540
     gaattaactg gtcaagatac tgcagcttat gggttagatc taggaggatc tataagttta       600
     gttgatgtag taaataaagt aacggaaatt gatggagact ttatgataag aattggcatg       660
     atgacgccag aacaggctat gagaataata gataatttaa tagaagtcat gagaaaccct       720
     aaggtgtata agtttatcca tttaccagtc caaagtggag atgatagagt attaaagcta       780
     atgaatagga aatatacaat agacgaatat aaagagttgg taagtgaaat aagaagtaaa       840
     ataccatttg ccaatataac tactgatata attataggtc atcctggaga agatgaagat       900
     gcatttaata ataccctatt gcttatgaag gaattaagat ttgaaagaat acatttagca       960
     atgtactcca tcaggccaaa tactagaagt gcatcaatgc cccaagttcc agatagtgta      1020
     aagaaaaaga gaattcaaat agctaataaa ctatatgagg atatcgcgtt atctattcat      1080
     ttagaatacg tgggaagtac tagcagagtt attacaacag aattaggtcg taaaggatct      1140
     gtagtaggaa gattgatgaa ttatattcca gtcgtgatca ggtctgaaaa tgtagaacta      1200
     ggaaagtggt ataatgttaa aataactgaa gcatcatttt atgacttacg tggagttttt      1260
     gcttaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page