(data stored in ACNUC7421 zone)

EMBL: CP001402.PE193

CP001402.PE193       Location/Qualifiers
FT   CDS_pept        166240..166536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0195"
FT                   /product="Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40829"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK88"
FT                   /protein_id="ACR40829.1"
FT                   /translation="MKVFLNIIRAQGMTLVNICQEELLGKVFREGEIILNVSEKFYGGE
FT                   SVELDYALSLIDEATVMSIVGNYAVEEAIRRGLVHKDSVINVAGVKFAQVYNV"
     atgaaagtgt ttctaaatat aattagagca caaggcatga cactggtaaa tatatgtcaa        60
     gaggaactat tagggaaagt attcagagaa ggggaaataa tactcaatgt tagtgagaag       120
     ttttacggag gagagtccgt agaattagat tatgcccttt cattgatcga tgaggctaca       180
     gttatgagta ttgtagggaa ttacgcggta gaagaggcaa taaggagagg gttagttcac       240
     aaggattctg tcatcaatgt agctggtgta aaattcgctc aagtttataa tgtgtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page