(data stored in ACNUC7421 zone)

EMBL: CP001402.PE194

CP001402.PE194       Location/Qualifiers
FT   CDS_pept        166542..167255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0196"
FT                   /product="NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40830"
FT                   /db_xref="GOA:C4KK89"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK89"
FT                   /protein_id="ACR40830.1"
FT                   /translation="MSGKFCVLCGKQNVELIDSLCADCYVKSKKLIEVPKRITGKYCKI
FT                   CGAQWIKGKWIRTSATSLASVVEDIIIREVGNKIDIDKNVEEFAFDIKSIWKDPSGNSF
FT                   ATIEFRGNVRGKPFSQEAIISLEMERTLCDSCFRKKTRYYEAIVQLRSKGKIGIDDKKR
FT                   AFFESFFSTSIVDNISDVIEGREGVDYYFMSKSVARKLISMISSIVDVEVNESYQNEKM
FT                   KNGKREAKLVISLRI"
     atgtcaggga agttctgtgt gctatgcgga aagcaaaatg ttgagctaat agactcactc        60
     tgcgctgact gctatgtaaa atctaaaaaa ctgatagaag tacctaaaag gataaccgga       120
     aagtattgca agatctgtgg tgcacaatgg attaagggaa agtggataag gacttcagca       180
     acatctctag cttcagtcgt ggaggatatt ataataagag aagtggggaa taagatagac       240
     attgataaaa acgtagagga gttcgcattt gatataaaga gcatatggaa ggatccaagt       300
     ggtaattcct ttgctactat tgaatttaga gggaacgtaa gaggtaagcc cttttcccaa       360
     gaggcgataa ttagtttgga aatggaaagg acattatgtg actcgtgctt taggaaaaag       420
     acacgatatt atgaggccat agttcaactg aggagtaaag gtaagattgg gattgacgat       480
     aagaagagag cgttcttcga atcctttttc tctacaagca tagtggataa tatttctgat       540
     gttattgagg gtagagaggg tgtggattat tattttatga gtaaaagtgt tgcaagaaag       600
     cttatatcga tgatatcttc tattgttgac gttgaagtta atgagagtta tcagaatgaa       660
     aagatgaaaa acggtaaaag ggaggcaaaa ctagttattt cattgaggat atga             714
//

If you have problems or comments...

PBIL Back to PBIL home page