(data stored in ACNUC7421 zone)

EMBL: CP001402.PE196

CP001402.PE196       Location/Qualifiers
FT   CDS_pept        167884..168939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0198"
FT                   /product="TGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40832"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK91"
FT                   /protein_id="ACR40832.1"
FT                   /translation="MVTNLPAEAKAKWLKVMDARTPEEKFQALQEFLKEVPKHKGTENL
FT                   VYWAKRRMAELREEMEVRKSKKSGGFSLFVEKEGAGQAILIGDLLLRSLIMKKLTNVKQ
FT                   EFNELPVPGMVKYEDVQIQLVNPPKSLPLTKTIGLIRNADEVIIVVNNKEELSFMRNIL
FT                   EENNILLRKPKGRVIIERTRYGISGIRIVNLGKLVDVDEKAVRDYIESFGIKSAIVKII
FT                   GEVALDDIEKSMFEAVSYKPTVVISKERFDTGELPILSIDHLDKLPKLLFEMLEVIRIY
FT                   TKEPGEESTKDPLILKKGSTVLDVARKLHSSLAENFRYARVWGRSVKFQGQKVGPSHVL
FT                   EDKDIVEIHAK"
     atggtaacga atttacccgc tgaagccaag gctaaatggc taaaggtgat ggacgcaagg        60
     acaccagagg agaaattcca agctttgcag gaatttctta aggaagttcc taaacataag       120
     ggaaccgaaa atctggtata ttgggctaag aggcgaatgg cagagttaag agaagaaatg       180
     gaggtaagaa agagcaagaa aagcggaggt ttttcgttat ttgttgagaa agagggtgcg       240
     ggtcaagcga ttttgatagg agatttactc ctaagatcct taataatgaa aaaacttacc       300
     aacgtaaaac aagaattcaa cgagttacca gtgcctggca tggttaaata tgaggatgtt       360
     caaatacagt tggttaaccc acctaagagt cttccgctca ctaagacaat aggtctaata       420
     aggaatgcgg atgaggtaat tattgttgta aacaataagg aagaactatc ctttatgagg       480
     aatattttgg aggagaataa tatcttattg agaaaaccta aggggagggt tataatagag       540
     agaacaaggt atggaatctc tggaattagg atagtaaatt taggtaaact ggtggacgtc       600
     gatgaaaaag ccgtaaggga ttatatagag agttttggga ttaaatcagc aatagtgaag       660
     atcataggtg aggttgcctt agatgatata gagaaatcca tgttcgaagc agttagctat       720
     aagcctacag tagtaatctc taaggagagg tttgatactg gcgagttacc aatattgagt       780
     attgatcatt tagataagtt acctaagctt ctgtttgaga tgttagaggt gatcagaatt       840
     tacactaagg agcctgggga agaatcaact aaggatcctt tgatacttaa aaaaggttcc       900
     actgttctag acgtagcaag gaaactacat tcatcattgg ctgaaaattt tagatatgcc       960
     agggtttggg gaaggtcggt aaagttccag ggacagaaag taggcccctc acatgttcta      1020
     gaagataaag acatagttga gatccatgca aagtga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page