(data stored in ACNUC7421 zone)

EMBL: CP001402.PE197

CP001402.PE197       Location/Qualifiers
FT   CDS_pept        168991..170841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0199"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40833"
FT                   /db_xref="GOA:C4KK92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK92"
FT                   /protein_id="ACR40833.1"
FT                   /translation="MSIFNKRNNKQAVNNQGPSKIELLFYNSSLINSLVKSVDIKMKKA
FT                   GINQDPRLFASRLFLTLIFSIAISVMLVVFAVRFFEIYKLTLLTKYLAGFLTMMIFGII
FT                   IPPVVYLMQILQLSQLTENRRIGLDSEAPAFAAVFNVFLRSGLSARYVFDYLSKSTAMQ
FT                   YASQIASYVNKRVKYLGEGVESAIVESLNYSPSKIFNEFLTTYVTAVRTGAPVLDTMEA
FT                   KTKDILKNIETLASTAAENLSGIAEGFVIWLSSGFITFFLVLLLQAIFPSLFGSVPFPI
FT                   MAIFAMIMIPLINLLFIWVVDQIQFRFPERSLKAYKIFYVTFPIGLVVSFIILYLIKEP
FT                   IPLLLNLLFLNAGVQQIPLSVLAFTIGLLIAVIPPAVIAVRELREGTGYDVYVVSFLRA
FT                   VAEGLRAGLNPATVVRNLKDSPEMGKFRDILNTIYAYSLLGVPIKDAFRIASERILDFS
FT                   SKVSLISLADMIEIGSLTPETVESLAEQVDAQIRIRRNYNAKIRVLLYAPYIGIILALV
FT                   ASILLGNAMFTLISHQSYSLSYGPLSNAAVILPKSLYIISISALFNSFLAGLLVGKIGY
FT                   GKTAAGFIHSAILVVITAILVVISLHISLIPSISPSSTSL"
     atgagtatat ttaataagcg taataacaaa caagctgtta acaatcaagg tccatcaaaa        60
     attgaattac tattttacaa ttccagtcta atcaatagtt tagttaaaag tgtagacata       120
     aagatgaaaa aagctggaat aaaccaagat ccacgtttat ttgcatctag gctatttctt       180
     actcttatat tttcaattgc aatttccgta atgttagtag tgtttgctgt aaggttcttt       240
     gagatataca aattgacatt acttacaaaa tatttggcag gatttttgac gatgatgata       300
     tttggcataa taataccacc tgtagtttat ttgatgcaga ttcttcagtt atcacaatta       360
     actgaaaata gaagaatagg tttagatagt gaagctccag cattcgctgc agtatttaat       420
     gttttcttaa ggtctgggtt aagtgcaaga tacgttttcg attacttatc taaatctaca       480
     gcaatgcaat acgctagcca aattgcctca tatgttaata agagagttaa atacttagga       540
     gagggtgtag aaagtgccat agttgaatca ttaaattact caccttcgaa aatattcaat       600
     gaatttttaa caacttacgt tacggcagtt agaactggag caccagtttt agatacgatg       660
     gaagctaaga ctaaagatat ccttaagaat atagaaactt tagcgtctac tgctgcggag       720
     aacttgtccg gaatagctga aggtttcgta atttggcttt catctggttt catcacattc       780
     tttcttgttt tattgttgca agcgatattt ccatctctct tcggttcagt cccattccca       840
     ataatggcta ttttcgcaat gataatgata ccattaataa atctattatt catatgggtc       900
     gttgaccaga tacaatttag attccctgag aggtctttaa aagcatacaa gatattttac       960
     gttacatttc ctatagggtt agttgtctct tttatcatac tatatttaat aaaggaacca      1020
     atacctcttc ttttaaatct ccttttccta aatgcaggcg tacagcaaat accattatcc      1080
     gtattagcat ttacaatagg tctattaata gctgtcatac ccccagcagt aattgcagtt      1140
     agggaattaa gggaaggaac aggatatgat gtttatgttg tatctttttt aagggcagtt      1200
     gctgagggat taagagctgg gctaaatcca gctacggtag ttagaaactt aaaggattcc      1260
     ccagaaatgg gaaagtttag agatatacta aatacaatat atgcttattc tctattagga      1320
     gtccctataa aggatgcctt taggatagct tcagagagaa tattggactt ttctagtaaa      1380
     gtttccttaa tttcactagc ggatatgata gaaattggta gtctgactcc cgaaactgtt      1440
     gagtcattag cagaacaagt tgatgctcaa ataaggataa ggagaaacta taacgccaaa      1500
     ataagagtgt tactatatgc gccgtatata ggtattattt tggcattagt agcatctatt      1560
     ctattgggta atgctatgtt tactctaata tctcaccaat cttattcttt atcttatgga      1620
     ccgttgtcca atgctgctgt gatcttgcct aaatccctct acatcatctc aatttcggca      1680
     ctctttaatt catttttagc tggattgcta gtagggaaga taggttatgg taaaacagca      1740
     gcgggcttta ttcattcagc gattttagta gttataactg ctatcttagt tgtcatatca      1800
     ttacatatat ccctaatacc ttctatatct ccatcatcaa catctttata a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page