(data stored in ACNUC7421 zone)

EMBL: CP001402.PE198

CP001402.PE198       Location/Qualifiers
FT   CDS_pept        170865..172598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0200"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40834"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK93"
FT                   /protein_id="ACR40834.1"
FT                   /translation="MSKVFKSLLPKGKPNVKQLPITELPITLYPVSPFPEEVTTIAADY
FT                   EVNILSLAPEDVKSNITRNNIELVLPNPHIFVTFDERKGIYKYVLLEPPVNDTIYNMYN
FT                   IFIEEIERELLSKTPSLDLAKIIFELNKKRSDLNIIQEKRGDIYILTTNARVTLYYLLR
FT                   NMFGYNVLTSLVADKNIEDISVSGLNNPVYVYHRSYEYIPTNIMFTKNMKISPQLNIMI
FT                   DGEELLDQLVLRMLSTTGKSISVAEPIQDGMLPNGDRIAATFRREVSASGSSVVIRRFS
FT                   ERPITILDLINSGTLSPELAAYLWYGMDLRMSVMSIGVTGAGKTTLLNAVLNLVKESMK
FT                   IVSIEDIPEIRLAHTNWVQLYARPAYAGVGKEISLMDLLKLSLRYRPDIIVVGEIRGQE
FT                   AYVLFQAISTGHGGATTFHAYNTDSAIKRLMNEPLNIPQEWIPMMNIMMTIRRLPVYVG
FT                   EKIVLRRRVVAVDEIVSWNDYRRVSSWDPKGDVFTINLDSARVLRNRIEEAGLNIDDVK
FT                   REMERRALFLKLLASSREIIQSEESYKLVKKYIIKYSLKPEEALKEVQTMAGVKTIELK
FT                   E"
     atgagtaaag ttttcaaatc tctcttgcca aaaggcaaac ctaatgtgaa gcaattacct        60
     atcacagaac tacctataac actctatcca gttagccctt ttccagaaga ggtaactaca       120
     attgcggcag actatgaagt gaatatacta agcttagccc cagaggatgt caagtctaac       180
     ataacccgaa ataatataga gttagtattg ccgaatcctc acatctttgt tacctttgat       240
     gaaaggaagg gtatatataa atatgtttta ttagaaccac cagttaatga taccatttat       300
     aacatgtaca atatattcat agaagagata gagagagaat tactttctaa aacaccctca       360
     cttgaccttg caaaaattat atttgaactt aataagaaaa gatctgatct taatattatt       420
     caagagaaaa gaggagatat atatatatta actacaaacg caagagttac gttatattac       480
     ttgttaagga acatgttcgg atataatgta ttaacttcac tggttgctga taagaatata       540
     gaagatattt ctgtttctgg tttgaataat ccagtctatg tatatcatag aagttatgaa       600
     tacataccaa ctaatattat gtttactaag aatatgaaga tatctccgca gcttaatatt       660
     atgatagatg gcgaggaatt gttggatcaa ttagtgctaa gaatgctttc aaccacaggt       720
     aagtcaattt cagttgctga accaatacaa gacggtatgc taccaaatgg tgataggatt       780
     gccgcaacat ttaggcgtga ggtatcagcc agtggttctt cagtagtgat aaggagattc       840
     agtgaaaggc ctattacgat actagattta atcaattctg gcaccttatc tccagagttg       900
     gccgcatacc tatggtatgg aatggatctg agaatgagtg ttatgtcaat aggggttact       960
     ggtgctggaa agaccacttt gcttaatgca gttctgaatc tagttaaaga aagtatgaag      1020
     attgtctcca tagaagatat cccggaaatt agattagccc atactaattg ggtccaactg      1080
     tacgctaggc cagcatatgc aggagtaggc aaagagattt cattaatgga tttgttaaaa      1140
     ttatccctca gatataggcc agatataata gtagtaggcg agataagagg gcaagaggcg      1200
     tacgtattat tccaagcgat atcaactggt catggaggtg ctacgacgtt ccacgcatat      1260
     aataccgact ctgcaataaa gaggcttatg aatgagcctc ttaacattcc acaagagtgg      1320
     atacctatga tgaacataat gatgacgatt agaaggttac cagtatatgt aggcgagaag      1380
     atcgttctaa ggagacgtgt tgtagcagtt gatgaaatag ttagttggaa tgattataga      1440
     agggtctcga gttgggaccc aaaaggtgac gtgtttacaa tcaatcttga ttctgccaga      1500
     gtattaagaa atagaattga ggaagctggt cttaatatag atgatgttaa gagggagatg      1560
     gagaggagag cattattcct aaaattattg gcatcttcta gagagataat acaaagtgag      1620
     gagagttata agcttgtgaa gaaatatata ataaaataca gtttaaagcc agaagaagct      1680
     ctaaaagaag ttcaaacaat ggctggagta aaaactatag aactaaaaga ataa            1734
//

If you have problems or comments...

PBIL Back to PBIL home page