(data stored in ACNUC7421 zone)

EMBL: CP001402.PE2

CP001402.PE2         Location/Qualifiers
FT   CDS_pept        842..2029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40638"
FT                   /db_xref="GOA:C4KJB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB8"
FT                   /protein_id="ACR40638.1"
FT                   /translation="MNVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIYNEIEEVKNEDEEYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIKAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDGDILGYIAAISAKEHGDARKAVNLLFRAAQLASGGGMIKKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIVNRGRAGGVKKYALVEDKEKVLRALNETFEDSIGIGDFVDDVGEN"
     gtgaatgtga taagggaaac attgaaaggt ggtaaaggtg aagttataaa aaaccctaag        60
     gtctttattg atccgttatc tgtatttaag gagattccgt tcagagagga tatactaagg       120
     gatgctgcaa tagctattag gtattttgtt aagaatgagg tcaagttttc gaacttgttt       180
     cttggattaa ccggtactgg gaagactttc gtaagtaaat acatctataa cgagattgag       240
     gaggttaaga atgaggatga ggaatataag gatgtaaaac aagcttatgt taattgtaga       300
     gaagttggtg gaacaccaca agcagtatta tcatccttag ctggtaagct gactggtttt       360
     tcagtgccta agcatggtat taatctaggt gagtacattg ataagataaa gaatggtact       420
     aggaacataa aggccataat atatcttgac gaggttgaca cattagttaa gaggagaggg       480
     ggagatatag tactttatca actgctaagg tcagatgcta atatatcagt tattatgatt       540
     agtaatgaca taaatgttcg tgactatatg gagcctagag ttttatcatc cttaggtcct       600
     tcagttatct ttaaacctta cgacgcagaa caactgaaat ttatcctttc aaagtacgca       660
     gaatacggtt taataaaagg tacctatgat ggtgatatac tgggttatat tgcagctatc       720
     tctgctaaag aacatggtga tgcaagaaag gcagtcaatt tgcttttcag agcagctcag       780
     ctagcttctg gtggggggat gattaaaaag gagcacgtag ataaggcgat cgtagattat       840
     gaacaagaga ggcttataga ggccgtaaaa gcccttcctt ttcactataa attagcttta       900
     agaagtctaa tagagtcaga agatgtgatg tctgctcaca aaatgtatac tgatctttgt       960
     aataagttca aacaaaagcc tttatcgtat agaagatttt cagacataat atcggagttg      1020
     gatatgtttg ggatagttaa gataaggata gttaataggg gtagagctgg tggagttaag      1080
     aagtatgctt tagtggaaga taaggagaag gtgttaaggg cacttaatga gacttttgaa      1140
     gatagtattg gtattggtga ttttgttgat gatgtgggag aaaattaa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page