(data stored in ACNUC7421 zone)

EMBL: CP001402.PE20

CP001402.PE20        Location/Qualifiers
FT   CDS_pept        18044..18724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40656"
FT                   /db_xref="GOA:C4KJD6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD6"
FT                   /protein_id="ACR40656.1"
FT                   /translation="MSKGAEILILFTVFVFTLNIISNAYVVNVKILSPFPVTLLFSDSH
FT                   GVKLVSSNQTLNVNSSNLRIQAFVLAPYSYSILINGNNTNELNVNLSNYSEFNLTVIVI
FT                   PSYAFLKVDVVGKGTVYIELNNGTIIAVRNSSVVKLYNGSNVLLEASGDLLNWSNGGNT
FT                   MTIWYSVNGNSTITAFFGNSSILLKSGTVKPIVNYTEVGLSLFAIGFFVLYKIYSRKDQ
FT                   DTNV"
     gtgtctaaag gagcagaaat ccttatattg tttacagtat ttgtatttac gctaaatatt        60
     attagtaacg catacgtagt taatgtaaaa attttaagtc cctttccggt tacattactg       120
     ttttctgact cccatggtgt caaattggtt tcttccaatc aaactctaaa cgtcaatagt       180
     tcaaatttaa ggattcaggc ttttgtttta gccccctatt cctattctat acttattaat       240
     ggcaataata ctaatgaatt aaacgttaat ctgtccaatt actctgaatt caacctcaca       300
     gtaatcgtta ttcctagtta tgcctttttg aaagttgatg tagttggaaa gggtacagtt       360
     tatattgaat taaataatgg tactattatt gcagttagga actcttctgt ggttaaatta       420
     tataatgggt ctaacgttct tcttgaggct agtggagatc ttcttaattg gtcaaatggt       480
     ggtaatacca tgactatttg gtactcggtt aatggtaact caacaattac agcgtttttt       540
     ggtaattcta gtattcttct aaagtctggt actgttaaac ctatagtaaa ttacacagaa       600
     gtaggactta gtttgtttgc gataggattt ttcgtattat ataaaatata ttctagaaaa       660
     gaccaagata ctaatgtttg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page