(data stored in ACNUC7421 zone)

EMBL: CP001402.PE202

CP001402.PE202       Location/Qualifiers
FT   CDS_pept        complement(174959..176329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0204"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40838"
FT                   /db_xref="GOA:C4KK97"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK97"
FT                   /protein_id="ACR40838.1"
FT                   /translation="MGSSWKYESEKAMIKPVGMTVAGLDTGNGAGGETDLRVFEVLGIH
FT                   GVFAITAITAQSTRGIKDINVVSSEFLKKQIETLLDDFNVEAVKMGMIYTKEQFQVVNE
FT                   LLHDSFLVVDPVLYAKDGTPLIKDVEDYKKIILPIAKVITPNIIEASAISGIKVEKESD
FT                   VVIACKKIRETYNIAHVIIKGGHSKGDFSFDYMCNEEGVYKIGYHKIQAKDTHGTGSVF
FT                   ATAFTAEYIKTKDVKLAFRKARDFVQSPIEYGLNIGKGVGPVNVSIEIMKKSMKYEVVE
FT                   EMRRFADFAENNEKFWILIPEVQSNLAHSIKPEYVRDLNDIATFRGRIIRRWDKKVIVG
FT                   HPVVFGNPTHTARMLLSIILKGMNSTCLMNIRYDDKIVESFKEIGYETVEINRELEPSH
FT                   GEGKTMQWIIEYISGEYVRIPNVIYDKGTKGKEAMIRFWTKNMEEMIEALDNLLKML"
     ttgggtagta gctggaaata cgagagtgaa aaagcaatga ttaaaccagt tggaatgacc        60
     gtagctggat tagatactgg taatggagca ggaggagaga ctgatctaag agtttttgaa       120
     gtattaggaa ttcacggagt ttttgcaatt actgcaataa cagctcaaag tacaagaggt       180
     ataaaagata ttaatgttgt tagctctgaa ttccttaaaa aacagataga aacattactt       240
     gatgatttca atgtcgaagc tgttaagatg ggaatgatat ataccaaaga acagtttcaa       300
     gttgtgaatg aattattaca cgattctttt ttagtagtag acccagtact gtacgcaaag       360
     gatggaaccc cgctaattaa agacgttgaa gattacaaga agataatttt acccattgct       420
     aaggtaataa caccaaacat aatagaagca tctgcaatta gcggtattaa ggtagaaaag       480
     gaaagtgatg tagttattgc atgtaaaaag ataagggaga cttacaatat tgctcacgta       540
     ataattaagg gaggccatag taagggagat tttagcttcg attacatgtg taatgaagag       600
     ggagtatata agataggtta tcacaagata caagcaaaag acacacatgg cactggcagc       660
     gtatttgcaa ctgcgtttac tgcagaatat ataaagacga aggatgtaaa attggccttt       720
     aggaaagcaa gagattttgt tcaatcccca atagaatatg gacttaatat agggaaaggt       780
     gtaggaccag ttaacgtaag tattgagatc atgaagaagt ctatgaaata tgaagtagtt       840
     gaggaaatga gaagatttgc agactttgct gaaaataacg agaaattctg gattttaata       900
     cccgaagtac aatcgaatct agcacacagt ataaaaccag aatacgttag ggatctaaac       960
     gacattgcta catttagagg tagaataata aggaggtggg ataaaaaggt aattgttggt      1020
     catcccgtcg tatttggaaa tccgacccat acagccagaa tgttattatc aattattctc      1080
     aagggaatga atagtacttg cttaatgaac attagatacg acgataagat agttgagagt      1140
     tttaaggaaa ttggctatga aactgttgag attaataggg aattggaacc tagccatgga      1200
     gaaggaaaga cgatgcagtg gattattgag tatataagtg gtgaatacgt taggatacct      1260
     aatgtaattt acgataaagg taccaaggga aaggaggcaa tgattagatt ttggacaaaa      1320
     aatatggagg agatgataga agctttagat aacttattaa aaatgctgta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page