(data stored in ACNUC7421 zone)

EMBL: CP001402.PE203

CP001402.PE203       Location/Qualifiers
FT   CDS_pept        complement(176290..176985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0205"
FT                   /product="MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40839"
FT                   /db_xref="GOA:C4KK98"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK98"
FT                   /protein_id="ACR40839.1"
FT                   /translation="MKKVKVLYFAFIKDITHKSNEVLETECEDVGCLIEQLGKMYGNEL
FT                   VNFLKNGINGIKVSILVNGSASTKNIKDGDEVALLPPPSGGDLIIGKRFDLLEEIRKFR
FT                   EKAPPEAGSLVVYVGFVKGIVDNHKVLELRYEAYEEYTRKRFLEIKEEMKRKYSDLIDL
FT                   EIIHVIESMKPGENVLLIMALGKGRKDAIDAVKETLELVKHSTGIWKLEIRDDGEYWVV
FT                   AGNTRVKKQ"
     atgaaaaaag tgaaagttct ctattttgca ttcattaaag atataaccca taagtcgaat        60
     gaagtattgg aaactgagtg tgaagacgtt ggctgcctca ttgaacaact aggtaaaatg       120
     tacggaaatg aattagtaaa cttcttgaaa aacggaataa acgggataaa agtttcaatt       180
     ttggtaaatg gttcagcatc aactaagaat attaaagatg gagatgaggt agcactatta       240
     ccaccacctt ctggtggaga tttaattata gggaaaaggt tcgacttact tgaggaaatt       300
     aggaaattca gagaaaaagc ccctccggaa gcaggctctt tagttgttta tgtaggtttt       360
     gttaaaggta tagtagacaa tcacaaagtc ttagaactga gatacgaagc ttatgaagag       420
     tacaccagga agaggtttct agaaataaaa gaagaaatga agaggaaata tagtgacttg       480
     attgaccttg agataataca tgtaatagag tccatgaaac ctggagagaa tgtcttactt       540
     ataatggccc taggcaaggg aaggaaagat gccatagatg cggtgaaaga aacattggaa       600
     ttggttaaac atagcactgg aatttggaaa ttggaaataa gagatgatgg agaatattgg       660
     gtagtagctg gaaatacgag agtgaaaaag caatga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page