(data stored in ACNUC7421 zone)

EMBL: CP001402.PE204

CP001402.PE204       Location/Qualifiers
FT   CDS_pept        177023..177478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40840"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK99"
FT                   /protein_id="ACR40840.1"
FT                   /translation="MSEDEIIDLIFNNQRDIRQGTAIRKENNEVLNKLNEIEKLLQYLI
FT                   KSKERGVQQNGSLCEQILSSTYVILDENNGDVGGKYFIIDLDSSRKLVTFKDTIELLNF
FT                   HFSQTVNEQDLDDKLPKRLIPLFRFLRRNGLIYFDYDKKRYFIVDYK"
     atgagtgaag acgagataat agatttaata ttcaataatc aacgtgatat aagacaaggt        60
     acagcgatta ggaaggaaaa caatgaagtt ctaaacaaat taaatgagat agagaagctt       120
     ctacaatatc taattaagag taaagaaaga ggagttcagc aaaacgggag tttatgtgaa       180
     caaattcttt catcaactta tgttattctt gatgaaaata atggggatgt aggtggaaaa       240
     tatttcataa tcgacctaga tagttctaga aaactagtta catttaaaga tacaatagaa       300
     cttcttaatt tccacttttc tcaaaccgta aatgagcaag atttagatga taagcttcct       360
     aaaaggctga tcccattatt tagattcttg agaagaaatg gtttaatata ctttgactac       420
     gacaagaaaa gatattttat tgttgattat aagtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page