(data stored in ACNUC7421 zone)

EMBL: CP001402.PE205

CP001402.PE205       Location/Qualifiers
FT   CDS_pept        complement(177469..179724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0207"
FT                   /product="iron-sulfur protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40841"
FT                   /db_xref="GOA:C4KKA0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA0"
FT                   /protein_id="ACR40841.1"
FT                   /translation="MILDASIFSRAVIGGYDVKKIESTDKNELVVGRLTGLYGDVLKYT
FT                   NSKIIRAPDRFSDGSIFREVEGRNIYKIFEVPAGVTFDKLIDELSKNNYYPAIFPLYLK
FT                   GTIGGFTVSNGSGFGSYKFGFVKGKKTINELIDYKVVRILAVKYPELIETEGENKFAWS
FT                   ALIYKDTIKYYIPSFYNKIINENFKSVSTNNLIKSINIEISSIFKRNYVPIILMTNYEK
FT                   NTEFNFDFKMGYIINYNSPRRYKVLIGSLEETRLPELFEYLKKNPDVLPFPYLKEYEEF
FT                   HKDILRNFKKYEIKVRSKRINKNMIIEASKCINCSLCLDSCLAYNTTNNILYSPLGRFD
FT                   RLLTGEGNFEFCFGCASCQEACPVGINISNLMEILPQFNENKETVELETTDVTRTIYEL
FT                   EKNLDTKYRNRPVFLLFVGCAAKYDPLGLEGFLSYLLISGDKLSQELSPRVRLVTGVCC
FT                   GFSDYLAGNLEGVKKSVEKINRLRIEQNAAGIYFLCPEGLYVYNKFSEQKGIFAYEIIK
FT                   NELKEKEVHLGCWAKKLGYSSRYNECAGLFLTSYKGSPLRATKKGFLTVCPFSTWKFGT
FT                   ISVYSLFLEKKEVKQLEEEKVMINENVIFDLLVRAIADGLIASKDEIAEKVVMWSLGGS
FT                   QYFLLLTIPIFSKYISSELIRKLSSDYRVKEFLSKLSQDPPLLNQKISTYKDYLSSYNF
FT                   NNEINALLEEIAKSNKLDYSIKDLVKTNEFLNVLKQALRRSINENLIASAINNIIYL"
     atgattttag acgcatcaat atttagtaga gctgtaatag gaggctatga tgtaaaaaag        60
     atcgaaagta ccgataaaaa tgaattggta gttggtagat taaccggttt atatggtgat       120
     gtattaaaat atactaattc gaaaataata cgtgctccgg atagatttag tgacggaagt       180
     atatttaggg aagttgaagg aaggaatata tataaaatat tcgaagtacc tgccggagta       240
     actttcgata aactgataga cgaactttcc aagaataatt attaccctgc aatctttcca       300
     ttatatttaa aaggtactat tggaggattt actgtatcaa atggttcagg gtttggtagt       360
     tataagtttg gatttgtaaa aggtaaaaag actataaacg agctaattga ctataaggta       420
     gtaagaattc ttgcagtaaa atacccagag ctgatagaaa ctgaaggcga aaataagttt       480
     gcttggtcag ctctaatata caaggatact ataaagtatt atataccctc attctacaat       540
     aaaataatca atgaaaattt taaatcagta tcaacaaata atttgataaa aagtataaat       600
     atagagatat ctagtatatt caagagaaat tacgtaccaa taatactgat gactaattac       660
     gaaaaaaata cggaatttaa tttcgatttt aaaatgggat atataatcaa ttacaactca       720
     ccgaggagat ataaagttct gataggaagt ctagaggaaa ccagattacc agagctcttt       780
     gagtatctaa aaaagaatcc agatgtatta ccgttcccct atctgaaaga gtatgaagag       840
     tttcataagg atatactaag aaactttaaa aaatatgaaa taaaagtaag atctaagaga       900
     ataaataaaa acatgataat cgaagcgtcg aagtgtataa attgttcatt atgtttagat       960
     agttgccttg cgtacaacac taccaataat atcctttatt cacctttagg tagatttgat      1020
     agattattaa caggcgaggg aaattttgaa ttctgctttg gatgtgcttc ttgtcaagag      1080
     gcttgcccag taggaataaa tatttccaat ctaatggaaa tattaccgca atttaatgaa      1140
     aataaggaaa cagtagaatt agaaacaaca gacgtaacaa ggactatcta cgaattggaa      1200
     aaaaacttag acactaaata taggaataga ccagtcttct tattatttgt aggatgtgca      1260
     gcaaagtatg atccattagg actagaagga tttctaagtt acctcctaat tagcggagat      1320
     aaattgtctc aagagctatc tcccagagta agactagtta ctggagtttg ttgtggtttt      1380
     agcgattacc tagcggggaa tctagaaggt gtgaaaaaaa gtgttgagaa gataaatcgg      1440
     ttaagaattg aacaaaatgc tgctggtatt tattttctat gcccggaggg attgtatgtt      1500
     tataataagt tcagtgaaca gaagggaata tttgcgtatg aaattattaa aaatgaacta      1560
     aaggagaaag aagtacattt aggatgctgg gctaagaagc ttggatatag ttcacgatat      1620
     aatgaatgtg cagggttgtt cttaacatct tataaaggca gcccacttag agctactaaa      1680
     aaaggtttct taactgtatg tccattttct acgtggaagt ttggaacaat atcagtgtat      1740
     agtttattcc tagaaaagaa agaggtaaag caacttgagg aagaaaaagt catgataaat      1800
     gagaatgtaa tattcgattt gttagtgagg gccattgcag atggtttaat agcttctaag      1860
     gatgaaatcg ctgagaaagt agtcatgtgg agtttaggag gtagtcaata cttcttattg      1920
     ctaactattc caattttctc taaatatata agcagtgagc tcatacgtaa attatcctct      1980
     gactatagag taaaggaatt tttatctaaa ctgtcacaag atccacctct actaaaccag      2040
     aaaatttcca catataagga ttatctttcg agttataatt ttaacaatga aataaatgct      2100
     ctactggaag aaatagcaaa atcaaataaa ctagattatt ctataaaaga tttagttaag      2160
     actaatgaat ttttaaatgt attaaagcaa gccttaagaa gatctataaa tgaaaaccta      2220
     atcgcaagtg ctataaataa tattatttac ttataa                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page