(data stored in ACNUC7421 zone)

EMBL: CP001402.PE206

CP001402.PE206       Location/Qualifiers
FT   CDS_pept        179772..180521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0208"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40842"
FT                   /db_xref="GOA:C4KKA1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA1"
FT                   /protein_id="ACR40842.1"
FT                   /translation="MEIKVPISISGIWYPLVDSENLMESGSVGLALTLEPYITAEIRGG
FT                   SGIEFNGIEIKLPNYEILKKKLGEYRLSVYSEVPLGYGYGLSGAISLAYALGVKELAPI
FT                   SEKDAVNVAHLSDVIAGNGLGDVIAQYYGGGLVYRKKAGGLGYGEVEIINMDWSQYPIF
FT                   SQPISHLPTKSIIKRSEIALKLIDEFLKNPSPLKFIEVAQKFTSSLGFNSEYPYSYRKK
FT                   GIIVKIFDPEYGVWIKHKIASRGAYVI"
     gtggagatta aagtaccaat ttctatttct ggtatatggt atccgttggt agatagtgag        60
     aatttgatgg aatctggatc tgtagggttg gccttaacat tagaaccata tataactgct       120
     gaaattagag gcggtagtgg gatagaattt aatgggatag aaataaaact tcctaattat       180
     gaaatattaa agaaaaaatt aggagaatat aggttatctg tatattctga agtaccatta       240
     ggttacggct atggcttaag tggggctata agcctggcgt atgccctagg agttaaggaa       300
     ttggcaccaa taagtgagaa ggatgcagtt aatgtagccc atttaagtga tgttatagcc       360
     ggaaatggat taggggatgt aatagcacag tattatggtg gaggtttagt ttataggaag       420
     aaggcaggag ggttgggtta tggcgaggtt gagataataa atatggattg gtcacaatac       480
     ccaatcttct ctcaacctat tagccatctt ccaactaaga gtattataaa gaggtcagaa       540
     atagccctta agctcataga cgaatttctc aaaaatccgt ctccgttgaa atttatcgag       600
     gttgcacaaa agtttacaag tagtttgggt tttaactcag aatatcctta ttcatatagg       660
     aagaagggga taattgttaa aatctttgat ccagagtatg gagtatggat aaagcacaag       720
     atagcaagtc gtggagcata cgtgatataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page