(data stored in ACNUC7421 zone)

EMBL: CP001402.PE207

CP001402.PE207       Location/Qualifiers
FT   CDS_pept        180476..181276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0209"
FT                   /product="Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40843"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA2"
FT                   /protein_id="ACR40843.1"
FT                   /translation="MDKAQDSKSWSIRDIIPENHPRRESLLIREKLIEAMEKSILVPQG
FT                   LIAHGRGECFDYLIGEKTQDFAEKAIEAAAATLLLAKTPVISINGNMAALVPEGLVRLA
FT                   EETNAKLEVNLFYRDERREKVIAEVLYKANAKEVLGVGEDASTVIPELFSQRRRVSPKG
FT                   IYIADVVLLGLEDGDRTEALVKMGKKVIAIDINPLSRTSRTATITIVDNIIRAIPRLVE
FT                   KVKEFKSKNKEELEQIVLNYNNKNVLAESLKFIANRLTQLSFSL"
     atggataaag cacaagatag caagtcgtgg agcatacgtg atataatacc agaaaatcat        60
     cctagaaggg aatccctatt aatcagagaa aaactgattg aagcgatgga aaaaagcatt       120
     cttgttcctc aagggttaat agcacatgga aggggagaat gtttcgacta cttaatagga       180
     gagaagactc aggatttcgc tgaaaaggct atagaagctg cagcagctac cctactctta       240
     gctaaaacac ccgttatttc cataaacgga aatatggctg cattagtccc agaaggtcta       300
     gtaagattgg cagaggagac aaatgccaaa ctcgaagtta atttattcta tagggatgaa       360
     agaagagaaa aagtaatagc tgaagtactt tataaggcaa atgcaaagga agttttagga       420
     gtaggtgagg atgcttcgac ggtaatacct gaattattta gtcaaagaag aagagtaagt       480
     ccaaaaggta tttacatagc tgatgtagta ttattgggtt tagaagatgg agatagaaca       540
     gaggcattag tcaaaatggg taagaaagtt atagcaatag atatcaatcc gttatcgaga       600
     acttctagga ctgctacaat aactattgtg gacaatataa ttagggctat tcccagacta       660
     gtagagaagg tgaaagagtt caagtctaag aataaagaag agttagaaca aatagtctta       720
     aactataata ataaaaatgt tctagctgaa tcactgaaat tcatagctaa cagattaact       780
     caactttctt tttccttata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page