(data stored in ACNUC7421 zone)

EMBL: CP001402.PE209

CP001402.PE209       Location/Qualifiers
FT   CDS_pept        complement(181955..182689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40845"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA4"
FT                   /protein_id="ACR40845.1"
FT                   /translation="MLLWLRNLLYAFEIIYKMIGTVKDRTLEALLKYGDKAKYVLKAII
FT                   EITEDNENRELGDFSYKQLVEKLGEFGVNYDPRMILRALEKDFGIIETTYKSANQHWWK
FT                   FIDIEQTKLALNGEINNSEEDPEISLIIIQYNSLNPKEVEKKLLFLLKKPKLLDLDKKN
FT                   FMKFSFEILPLIVKLYYKASQHEDTFEIAEKLKKIINLAKRISSRINNEKGDNKGLHKE
FT                   EINEGENYNINSIRLPNGEDNI"
     atgctattat ggctaaggaa cttattatat gctttcgaga taatatataa aatgattggc        60
     acagtcaagg acagaacatt agaggctttg ctcaaatatg gcgacaaggc taaatatgtc       120
     ttaaaggcta taatagaaat tactgaggat aatgaaaata gggagcttgg agacttcagc       180
     tataagcaat tagttgaaaa actaggggaa tttggagtta actatgaccc tagaatgata       240
     ttgagagcgt tggagaagga tttcggcata atcgagacca cttataagtc tgctaatcaa       300
     cattggtgga aattcataga cattgagcag actaagctag cgcttaatgg tgaaatcaat       360
     aacagcgagg aagatcctga aatttctctt ataattattc aatataatag cttaaaccca       420
     aaggaggtag agaaaaaatt actattctta ttaaagaaac ctaaactact tgacttagat       480
     aagaaaaatt ttatgaaatt ttcatttgag attttaccgt taatagtcaa gttgtattat       540
     aaggcttctc aacatgaaga tacctttgag attgctgaaa agttgaaaaa aattataaat       600
     ttagctaaga gaataagctc tagaattaac aatgaaaaag gtgacaataa gggacttcat       660
     aaagaagaaa tcaacgaagg agaaaattac aatattaaca gcatacgatt acccaacggc       720
     gaagataata tctaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page