(data stored in ACNUC7421 zone)

EMBL: CP001402.PE21

CP001402.PE21        Location/Qualifiers
FT   CDS_pept        18766..20697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0021"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40657"
FT                   /db_xref="GOA:C4KJD7"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD7"
FT                   /protein_id="ACR40657.1"
FT                   /translation="MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVDRDEMPDLDRLLQNAAMTITGESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPNMLI
FT                   ARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATN
FT                   DIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEGKYYTWTEDELKGALGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRK
FT                   MPYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPED
FT                   YAAALLASISAYEVLSEEKYYDLAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMAHIVVVDEKDGLAERLH
FT                   RTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
     atgaatgaga gattaaggaa ttctcaaagt ggttatttga ggaaagcggt aaatcatcca        60
     ataaattggt atacctggtc taacgaaata tttgaaattg cgaaaaggga ggataagccg       120
     atacttattg atgtaggtgc tgcttggtgc cattggtgta acgttatgga tgaagatacc       180
     tattcaaacc cagaaatagt taagatagtt aatgaaaatt tcattccagt taaggttgat       240
     cgagatgaaa tgcccgatct ggatagactt ctacaaaacg cagccatgac cataacaggt       300
     gagtctgggt ggcctttaac catattcatg acacccgagg gaaaggtctt ctttggtgga       360
     acttactttc ctccagaaga taagtatgga agaataggct ttaagaaatt attgttagag       420
     attttgagaa tatggagaga agacagaaac caaatattct catcttcaat agaccctaat       480
     atgctaattg ctaggaatac tggtggagtt ctaagttcaa gtgttctaga tgacgcgttt       540
     tcctatataa catcctattt tgacattgag tatggtggat taggatttgg cgctaaattt       600
     ccccatcctt ttgtggattt actattcctc aactacagtg ctactagagg agatgactta       660
     ggtaaaaaac ttggtctatt caccttaagg aaaatgtatt atggcgggat ttttgatcaa       720
     gttggtggag gatttcatag atatactgtt gatagagaat ggaagttacc tcattttgag       780
     aaactactta tagataatgc cgaattgatt tacgattatt ttacttatta tacggcaact       840
     aatgacatag aaattcttga tgccttaaga aattcagtag attttgtttt aagagaacta       900
     tacatggatg ggaaaggttt tgctaatagc ttagatgcag atagtgaagg tatggagggt       960
     aagtactata cgtggactga ggatgagctt aaaggtgctt taggaaatga ttatggtatt      1020
     gcgataaggg tattcgacct aaagaatact gtagaagttg agggcaggaa agttctattg      1080
     agaacaactg aacttaggga gctatctaag gtaacaggtt tacaagcaaa tgagataata      1140
     gagaaggtaa gtgagataag ggccaaacta ttgacgtata gagagcaaaa taggaaaatg      1200
     ccatatagag atgatagtac atacacttat cctaacgcaa agcttactga atctatactg      1260
     ttttcctcat taattttaaa caagggtatt gaggaggcta agcttgttct gagtaagtta      1320
     ggaaaaagtg ttagcaggag gttagatggt ggaaaagctg gattaccaga agattatgct      1380
     gcagcacttt tagcaagtat ctccgcatac gaggtattaa gtgaagaaaa gtattatgat      1440
     ttggcaattg aactcggtag aaacattgga ggtattaggc ctaataattt cactgacatg      1500
     cctaatgagt ctgcaaattc aatgtatatt agggcgttat tcaaattatc tctattatct      1560
     gatgagttta aagttgatga agggaaaatt aaacctctaa ttccctctct aaccgctgaa      1620
     aattctcaat ttattgctgg gatagttaat actatctcga gttacattaa tggtatggct      1680
     catatcgtag tggttgatga aaaggacgga ctagctgaaa gactgcatag aactgcgtta      1740
     cttacctatt atccctttaa attaattgaa agggtagatg acagtagaac tgattacgtt      1800
     agttcagtaa taagggctat gataaaatat aatgcgggaa agagtagagc atatgtttgt      1860
     ataggcaata cgtgtagtat gccagtaagt gaagaggaaa agattaaaca attacttaaa      1920
     actaagcttt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page