(data stored in ACNUC7421 zone)

EMBL: CP001402.PE211

CP001402.PE211       Location/Qualifiers
FT   CDS_pept        183434..184624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40847"
FT                   /db_xref="GOA:C4KKA6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA6"
FT                   /protein_id="ACR40847.1"
FT                   /translation="MLKTMIKKEIMDLRRDRKLLLGAIILPLILLPLIGIILYASIAVS
FT                   PPVIEIVNHNQSNLPYVQAVSHYITQNGGTVIYNDSNASIIPDVVIIFPNDFNINASNI
FT                   SKQASVYVKILISSNQEASNLVNNALGYLSYSLVYSRTEFLINSSNLQRVVNPSDILRP
FT                   LLVKNYVVTITGKNAPQSQANLSEIARIITLVLFPSATPVIFYVTDGIVGEKERRTLES
FT                   LLASPISINSFIFSKVIIAIILGVLSSLGDILGVVLFSSLMSFTFGLPLSLSTSFILIV
FT                   VLAYLLAVLLTAALSVVLLLALGGSMRNMQVINFLILSFGLIASFSALFINVANLQFPL
FT                   NLILLIPYEQLSLSLLYFVSGSTFISLSLLSGVLIVSVIILLVSSRLFNSERLLLK"
     atgctgaaga caatgataaa gaaagagata atggatttaa gaagggatag aaagctacta        60
     cttggggcta taattcttcc tcttatatta ttaccgctaa ttggtatcat actttacgct       120
     tctatagctg tatctccacc cgtgatcgaa atagtaaacc ataaccaatc aaacttaccc       180
     tacgttcaag ccgtttcaca ctacattact caaaacggag gaacagtaat ttacaatgat       240
     tcgaatgcaa gtataatacc tgatgttgta ataatattcc ctaatgactt caatataaat       300
     gctagcaata tctcaaaaca agcctctgtg tatgtaaaga ttctaatttc ctctaatcaa       360
     gaagcttcga atttagttaa taacgcatta ggctatttgt cctatagtct agtttacagt       420
     aggactgaat tcttgataaa ttcttctaat ttacagcgtg ttgttaatcc tagtgatatt       480
     ctaagacctc tattggttaa aaattacgta gttactataa ctggtaaaaa tgctccacag       540
     tcccaagcaa acctaagtga aatagctagg ataataactc tagtcctttt ccctagtgcc       600
     actccagtaa tattttacgt cacagatggg atagttggcg aaaaggaaag aagaacttta       660
     gaatctttac tggcttcacc gatatcaata aactccttca tattctctaa ggtaatcatt       720
     gctataatct taggagttct ctcatcatta ggtgacattc tgggagtagt attattttcc       780
     tccttaatgt cattcacatt tggtttaccg ctatccctta gtacatcatt tattctaatt       840
     gttgtactag cctacctact agctgtatta ctaactgcag cgttaagtgt agttttactt       900
     ctagctttag gaggatctat gcgtaacatg caagtgataa actttctcat tttatcgttt       960
     ggcctaattg cgtccttttc tgccctattt ataaatgtcg cgaatttgca gttcccactt      1020
     aatctaatat tgctaatacc ttatgaacaa ttaagtttat cattacttta ctttgtttcc      1080
     ggttctactt ttatttcatt atcactccta tcaggcgtgt tgatagtctc tgtgataatt      1140
     ttgttagtat cctcaaggct atttaattcg gaaagattac tgctaaagta a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page