(data stored in ACNUC7421 zone)

EMBL: CP001402.PE212

CP001402.PE212       Location/Qualifiers
FT   CDS_pept        184657..184890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0214"
FT                   /product="regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40848"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA7"
FT                   /protein_id="ACR40848.1"
FT                   /translation="MAEVVRAYILVSTTVGKEMEVADMAKKVSGVVRADPVYGEYDVVV
FT                   EVEAKSSDDLKKVIYEIRRNPNIIRTVTLIVM"
     atggcagaag ttgtaagagc ctacattctc gtatctacta ctgttggtaa ggaaatggaa        60
     gtagcggata tggctaaaaa agtatctggt gttgtaagag cagatccagt ttatggtgaa       120
     tatgatgtgg tagtagaagt agaagctaag tcatctgatg atttaaagaa agtaatatat       180
     gagataagaa ggaatcctaa cataataagg accgtgactt taatagtaat gtaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page