(data stored in ACNUC7421 zone)

EMBL: CP001402.PE213

CP001402.PE213       Location/Qualifiers
FT   CDS_pept        185154..185417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40849"
FT                   /db_xref="GOA:C4KKA8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA8"
FT                   /protein_id="ACR40849.1"
FT                   /translation="MKKKFISKIIWAEFFFTLIEIFLYLSMLKFYLSRMISHADVGYAQ
FT                   KGEGDYGDVSPVPLGSNESHDPPIVSRWLRAKSLHSIMNKDK"
     atgaagaaaa agtttataag taagataata tgggctgaat tctttttcac gttaatagag        60
     atctttttat atttgagtat gttaaaattt tatttatcaa ggatgatctc tcatgccgat       120
     gtgggctatg cccaaaaggg tgagggggat tacggagatg tgagccccgt gccgttgggc       180
     tcaaatgagt cccatgaccc acctatcgta agtaggtggt tgagggctaa gtccctacac       240
     tcgatcatga ataaagataa atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page