(data stored in ACNUC7421 zone)

EMBL: CP001402.PE214

CP001402.PE214       Location/Qualifiers
FT   CDS_pept        complement(185539..185856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA9"
FT                   /protein_id="ACR40850.1"
FT                   /translation="MPTIHLSLPEWMYDELKQKADELGIQMTDLVKLFIKKGLEGDFER
FT                   NEENEEKKENAKYDESIAFLEAKVAQLDSLLVEVLKKLQILEEEKDEEEEQVEVVDSNQ
FT                   S"
     atgcctacta tacatttatc gttaccagag tggatgtatg acgaacttaa acagaaggct        60
     gatgaattag gaattcaaat gactgattta gtcaaattgt ttataaagaa aggacttgaa       120
     ggagactttg agaggaatga agagaatgaa gagaaaaagg agaacgctaa gtatgatgag       180
     agtatagcct ttttagaggc taaagttgcg cagttagatt cattattagt ggaggtgtta       240
     aagaagttgc agatattaga agaggagaaa gatgaggaag aggaacaagt agaggtagtg       300
     gatagtaatc aaagctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page