(data stored in ACNUC7421 zone)

EMBL: CP001402.PE215

CP001402.PE215       Location/Qualifiers
FT   CDS_pept        186006..186182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0217"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40851"
FT                   /db_xref="GOA:C4KKB0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB0"
FT                   /protein_id="ACR40851.1"
FT                   /translation="MRVVTFKVEEDLLELLDRYAIKYGLNRSEAIRKAIEKMVRDELSK
FT                   ERVPVARVEKIKL"
     atgagagttg taacatttaa ggtagaagaa gacctattag agttattgga tagatacgct        60
     ataaaatacg gtttaaatag atcagaagca ataaggaaag ccatagaaaa gatggtaagg       120
     gatgagttat ctaaggagag agtcccagta gcgagggttg aaaagataaa gctctag          177
//

If you have problems or comments...

PBIL Back to PBIL home page