(data stored in ACNUC7421 zone)

EMBL: CP001402.PE216

CP001402.PE216       Location/Qualifiers
FT   CDS_pept        complement(186179..186814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40852"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB1"
FT                   /protein_id="ACR40852.1"
FT                   /translation="MVLKYFGHSCVLIDDKILIDPHDGGSIGLPKPDIKKVDLILITHD
FT                   HYDHNAYQIFEYKDLKMNFYGSLNYVNYTIRGIKSYHDKYNGKLRGQNSIYVIQKNDGE
FT                   KIVHLGDIGHLPDESIYKELYGANVLLIPIGGVITINYKEALEIIDKVSPKIIIPIHYW
FT                   IKGHYMPLDPPEEFLSNIKYEVRGIDLKNNLIDEKIEESKKLVYILSY"
     atggtactaa aatattttgg gcattcttgt gttttaattg atgataaaat attaattgac        60
     ccgcatgatg ggggaagtat tggtttacct aagccagata taaaaaaggt agatctaatc       120
     ttaataacac acgatcatta cgatcataac gcataccaaa ttttcgaata caaggatctc       180
     aaaatgaact tctatggttc tttaaattac gttaattaca ccataagggg aataaagagt       240
     taccatgata agtataacgg taaattaaga ggacaaaata gtatatatgt gatacaaaag       300
     aatgatggtg agaagattgt ccatcttgga gatataggtc accttccaga cgaaagtatt       360
     tataaggaat tatatggagc gaatgtcctt ttaataccca taggtggagt aataactata       420
     aattacaagg aagcactaga gataattgat aaagtttcac ctaaaattat aatcccaata       480
     cactattgga ttaaaggaca ttacatgcct ttagaccctc cagaagagtt cttatctaat       540
     ataaaatatg aggtaagagg aatagatctg aaaaacaatc ttatagatga aaagatagaa       600
     gagagcaaga aactagtgta tattttatcc tactag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page