(data stored in ACNUC7421 zone)

EMBL: CP001402.PE218

CP001402.PE218       Location/Qualifiers
FT   CDS_pept        complement(188015..188644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0220"
FT                   /product="protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40854"
FT                   /db_xref="GOA:C4KKB3"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB3"
FT                   /protein_id="ACR40854.1"
FT                   /translation="MNFYKIVRSWFGFKERDDYISASILNYLVTKEYDESELRDIIKGR
FT                   EIAVVGASPQLDKINKIEEDVIIAADGATNYLINIGVIPDIVVTDLDGLQTFHKNPIYL
FT                   VLAHGDNISLLPKVKEMDKVIPNSQVMPFGRLRLYGGFTDGDRAVVLAKYMGARKIRLY
FT                   AMDFESGIIGKYSKPYYKRDVPASMIKRKKLEIARMIIEQVLNYDE"
     ttgaactttt ataaaatagt aaggagttgg ttcggattta aagaaaggga tgactatatt        60
     tctgcatcaa tactaaacta tctagtaacg aaggagtacg atgagtctga attgagagac       120
     ataattaagg gaagggaaat tgcggtagtt ggagcaagtc ctcagttgga taaaataaat       180
     aagattgaag aggacgttat aatagctgcg gatggtgcca caaactatct cataaatata       240
     ggagttatcc ctgatattgt ggtaactgat ttggatggtc ttcaaacttt ccataaaaac       300
     ccaatatacc tagtgttggc tcatggtgat aatatcagtt tactacctaa ggtcaaggag       360
     atggataagg taattccgaa ttcacaagtg atgccttttg gtcgtttaag actgtatggt       420
     gggttcactg acggagatag ggccgtagtt ttagcaaagt atatgggagc taggaaaata       480
     agattatatg ccatggattt tgaatccgga attattggaa aatactctaa accatactat       540
     aagagagacg taccagcttc gatgataaaa agaaaaaagt tagaaatagc cagaatgata       600
     attgaacaag ttttaaatta tgatgaatag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page