(data stored in ACNUC7421 zone)

EMBL: CP001402.PE220

CP001402.PE220       Location/Qualifiers
FT   CDS_pept        complement(188825..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB5"
FT                   /protein_id="ACR40856.1"
FT                   /translation="MDKSLVAAEYLLRARRTLKEAQIAFEDGDLYYTVVRSLDTIENLA
FT                   RVLLALKDIFRYELLWNTTIMLNDESNIEKKLRDLELKLIPITLINESSLKTPTVIIRN
FT                   KEAEMLVDEITKILEEVEGIYDEYHD"
     atggataaaa gtctagtagc tgctgaatat ttgctcaggg ctagaagaac gttaaaagag        60
     gcacaaatag cctttgagga tggagatctt tactacactg tggtaagaag cttagatact       120
     atagaaaatt tagctagagt gttattggct ttaaaggata tatttagata tgaactcctt       180
     tggaatacta caataatgct taatgatgaa agtaatatag agaagaaatt aagggatctc       240
     gaactaaaac tgataccaat aaccttgata aacgagtcct ctttgaaaac tccaactgtg       300
     ataataagga ataaggaagc ggaaatgttg gttgacgaaa ttacgaaaat tctagaagag       360
     gttgagggaa tatatgatga atatcacgat tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page