(data stored in ACNUC7421 zone)

EMBL: CP001402.PE221

CP001402.PE221       Location/Qualifiers
FT   CDS_pept        complement(189210..189587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40857"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB6"
FT                   /protein_id="ACR40857.1"
FT                   /translation="MKLLLSVIEDLSSLFIEWYGDYVKKIIVGGKSFEKFDETEEVIYL
FT                   LVLDKVSKISLYARGEIFSFFYNKVKNKESTKNFILSHGDLPKIYGLILSPKELEYEIP
FT                   IIEYLNNHGKVLYSSEDEKNG"
     atgaagttac ttctaagtgt aattgaggac ttatcctctc tttttataga atggtacggg        60
     gattacgtga aaaagattat agttggtgga aaatcctttg aaaaatttga tgaaactgag       120
     gaggtaattt atttattagt gttagataaa gtctccaaaa tctcactcta tgctaggggt       180
     gaaatatttt cgttcttcta caataaggta aagaataagg agagtacgaa gaattttatc       240
     ttaagccatg gagatttacc taaaatctac ggattaatat tatctcctaa ggaattggaa       300
     tacgaaatac caataattga gtatctaaat aatcatggaa aagtactata ttcttcagag       360
     gatgagaaaa atggataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page