(data stored in ACNUC7421 zone)

EMBL: CP001402.PE222

CP001402.PE222       Location/Qualifiers
FT   CDS_pept        189620..190123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40858"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB7"
FT                   /protein_id="ACR40858.1"
FT                   /translation="MNENAESYLKERISITLPILNISVPCNTTCIMTSKYKHLLSIENF
FT                   KAQLEILDSLINLIEDKIYTLRYEIEDKFSHYKANINIDNLVYAIYKMIEEGGNMVLGE
FT                   KIYFGNKEVAYGDYTVLIGFHSLVEKIVKTDSNIRSLCDEIRYLSESTWEHFDKNIRRS
FT                   LNES"
     atgaatgaga atgccgaaag ttacttgaag gagcgaatta gtatcacttt accaattcta        60
     aacatatctg taccttgtaa tactacttgt attatgacga gtaagtataa acatcttctc       120
     tcaatagaga atttcaaggc acaattagaa atattagata gtctcattaa tttaattgaa       180
     gataaaatat acacgctaag atatgagatc gaggataagt tctctcacta taaggctaac       240
     attaatatag ataatttagt atatgcgatt tacaagatga ttgaggaggg tggaaatatg       300
     gtcctaggcg aaaagatata tttcggaaat aaggaagtag cttacggtga ttatactgtt       360
     ttaataggct tccacagtct tgttgaaaag attgtaaaga ctgattctaa cattagatca       420
     ttatgtgatg agataagata tttaagcgag tccacatggg aacattttga caagaatata       480
     aggaggtctt taaatgaaag ttag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page