(data stored in ACNUC7421 zone)

EMBL: CP001402.PE234

CP001402.PE234       Location/Qualifiers
FT   CDS_pept        201769..202299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0236"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40870"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC9"
FT                   /protein_id="ACR40870.1"
FT                   /translation="MPKREEKDIFDLMDEWIREMEEEFERIEREFMRGFKGKGEEVKQF
FT                   GPYVYGFRITVGPDGVPKIEEFGNVRKIRGKPMISEEREPLADVIEKGDEIKVVAEVPG
FT                   VNKEDIKVKVTNGGKKLVITAKSEERQYYKEIDLPAEVDEKSAKANFKNGVLEITLKKK
FT                   SPSSDSGVEIKVE"
     atgcccaaga gggaagaaaa ggatattttt gacttaatgg acgaatggat aagggagatg        60
     gaagaagaat tcgagagaat tgagagggaa tttatgagag gtttcaaagg caaaggagag       120
     gaagttaagc aatttgggcc atacgtttac ggatttagaa taaccgtagg accagacggc       180
     gtgccgaaaa tagaggaatt cggtaacgtt aggaaaatca gaggtaagcc aatgatatct       240
     gaagaacgtg agccattagc tgacgttatt gagaaaggtg atgaaattaa ggtagtagct       300
     gaagtgcctg gcgttaacaa ggaggatatt aaagttaagg tgacaaatgg tggaaagaaa       360
     ttagtgatta cagccaaatc agaggagagg caatactata aggagattga tttaccagca       420
     gaagtagacg agaagtcggc taaggctaat tttaagaatg gagttttaga gataacttta       480
     aagaagaaaa gcccttcgtc agattctggt gttgaaataa aagttgagta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page