(data stored in ACNUC7421 zone)

EMBL: CP001402.PE235

CP001402.PE235       Location/Qualifiers
FT   CDS_pept        complement(202315..202833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0237"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40871"
FT                   /db_xref="GOA:C4KKD0"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD0"
FT                   /protein_id="ACR40871.1"
FT                   /translation="MSEGPKVIFEETLVCPVCKSKTFKAIDYLYDTPHAGKLILSNWYC
FT                   ENCGYRFRDVKPYEAREPRVIEMRIENENDLRTIIYRSAFAKITIPELGIEIEPAGMSQ
FT                   GYISTIEGVLEIILDKVGDFCDKECENRIRLAMEGKIKFTLVLEDELGLSFIKSEKATV
FT                   KPLILTNSD"
     atgtctgagg gaccgaaggt aatatttgaa gagacacttg tatgcccagt ttgtaaatca        60
     aagaccttta aggcaataga ctacctatat gatactccgc atgctggaaa gctaatttta       120
     tcaaattggt actgtgagaa ttgtgggtat agatttagag atgttaaacc atatgaagct       180
     agagaaccca gggtaattga gatgaggata gaaaacgaga acgatctaag aacaataata       240
     tatagatctg cttttgctaa aataacaata ccggaattag gaatagaaat agaaccagct       300
     ggtatgtctc aaggttatat ctctacaatt gagggagttc tagagataat attagataaa       360
     gtaggagact tctgtgataa ggaatgtgaa aatagaataa gattagcaat ggaaggtaaa       420
     attaaattta cattagtact tgaggacgaa ttaggattaa gtttcataaa atcagaaaag       480
     gcaacagtaa aaccacttat tttaactaat tctgattaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page