(data stored in ACNUC7421 zone)

EMBL: CP001402.PE236

CP001402.PE236       Location/Qualifiers
FT   CDS_pept        202902..204473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0238"
FT                   /product="protein synthesis factor GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40872"
FT                   /db_xref="GOA:C4KKD1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035531"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD1"
FT                   /protein_id="ACR40872.1"
FT                   /translation="MKLPRENEEGKVEYKLILSGVTPERLQELASQMKYRLEEGDGEAF
FT                   YVIGVSNEGEIIGLSKSELEESIATLDMIAKLVNAKIVYRRDVEVRKDKYVAELLVRRY
FT                   KENLPVEVNVAVMGHVNAGKSTVTGALVLGRLDDGNGGLRTAIARHLHEVLSGRTSSIT
FT                   LRLIGFDDSGKIVNWQLKDPLDEAETTIKSTKIVRLIDLGGHERYLRTTLKGLLGYEVN
FT                   YVMLVVGADDGLSIMGKEHLALASILKFPIFVVITKVDKYPEDRIKGIVNDIKNVLKIP
FT                   GINRLALEVEDEDDVVNSILAIKTKRVVPIFRISNVSGKGLDLLIKFLNLLPPEAKNLD
FT                   EKETPLVYIDEAYNVTGVGTVVLGSVVRGKLRSNESVLIGPNKLGEFKEVKIKSIQVNK
FT                   VFVDSVLAGNIATFAIQGIEKESLRKGMVMVKGIPKVVRRFKARVFILHHPTTIREGYV
FT                   ATLHSYTIRQAVKFERIQSGFLRTGDTSEIVLHFLYRPEYLERGQIFVFREGRTRGVGI
FT                   VLEPIG"
     atgaaattac cccgagaaaa tgaagaagga aaagtagaat ataagcttat tctttctggc        60
     gtgacgccag agcgtcttca agaattagct tctcaaatga agtacagatt agaggaaggt       120
     gatggggaag cattttacgt tataggtgta agtaatgagg gggaaataat agggttatcc       180
     aagagtgaat tagaggaaag tatagctact ctagacatga ttgctaagct agtaaacgct       240
     aaaattgtgt atagaagaga cgttgaagta agaaaggata aatacgtggc tgaacttcta       300
     gttaggagat ataaggagaa tttaccagta gaggtcaacg ttgcagtaat gggtcatgta       360
     aatgcaggga aaagtactgt aactggtgcg ttggttctag gaagattgga tgatggaaat       420
     ggaggtttaa gaacagcaat tgcaaggcat ctccatgaag ttttatctgg tagaacatct       480
     tccattacat tgagactgat cggatttgat gatagcggta agatagtgaa ttggcaatta       540
     aaggatccac ttgacgaggc ggaaacaacg attaagagta ctaagatagt tagacttatt       600
     gatcttggag ggcatgagag ataccttaga accactctaa aaggattatt aggttatgag       660
     gtaaattacg ttatgctagt agttggagct gatgatggtt taagtataat gggcaaagaa       720
     catttagcct tagcttcaat attaaaattt cctatatttg tagttattac taaggtagat       780
     aaatatccag aagataggat aaaaggcata gttaatgata ttaaaaacgt tttaaaaatt       840
     cccggaatta atagattggc tctagaagtt gaggatgagg atgatgttgt aaattcaatt       900
     ttggctataa agactaagcg tgtagttcct atttttagaa tatcgaatgt aagtggaaaa       960
     ggtttagatt tgcttataaa attcctaaac ctattacctc cggaggctaa gaacttagat      1020
     gagaaagaga caccactagt ttatatcgat gaagcatata acgtaactgg agtgggtact      1080
     gttgtacttg gttccgttgt gagaggtaag cttaggagta atgagtctgt gttaattggg      1140
     cctaataagt taggagagtt taaggaggtt aagataaaga gtatacaagt aaataaggta      1200
     tttgtggatt ccgttttggc tgggaatata gccacatttg ctattcaagg tattgaaaag      1260
     gagagtctta gaaaaggaat ggtaatggtg aagggaatac ctaaggtagt tagaagattt      1320
     aaggcgagag tgtttatact tcaccatcca actaccatta gagaaggtta tgttgctacc      1380
     cttcactctt atacaataag gcaagcggta aagtttgaga gaattcagag tgggtttcta      1440
     agaactggcg atacgagtga aatagtattg cattttctgt ataggccaga atacttagag      1500
     aggggacaaa ttttcgtatt cagagaaggt agaactagag gtgtaggtat tgtattggaa      1560
     cctattggtt aa                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page