(data stored in ACNUC7421 zone)

EMBL: CP001402.PE237

CP001402.PE237       Location/Qualifiers
FT   CDS_pept        complement(204463..204870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0239"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40873"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD2"
FT                   /protein_id="ACR40873.1"
FT                   /translation="MTKTEGEIVIKDPNKAKQFFSDYKNLLTCIPGVKEINGNSFKAYV
FT                   KFSFLTIEINGTVKKHEINGDNIDTLITIEGPGIIANINTLLTILGNKIKWSSDYEVGG
FT                   PLANSLKKHIGSQAEEISKQIIECSVGKINQ"
     atgacaaaaa ctgaaggaga aattgttata aaggacccaa ataaggccaa acagtttttt        60
     tcagattata agaatctatt gacttgtatt cccggggtga aagaaataaa tgggaatagc       120
     tttaaggctt atgttaaatt ctcattttta actattgaaa ttaatgggac agtaaaaaag       180
     cacgaaatta atggagataa catagatacg ttaattacca ttgagggacc tggtataata       240
     gcaaacataa acacattact tacaattctt ggaaataaaa tcaaatggag tagtgattat       300
     gaagtgggcg gaccattagc aaatagttta aagaagcata taggttcaca agcagaggaa       360
     atatcaaagc agattataga gtgtagtgta gggaaaatta accaatag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page