(data stored in ACNUC7421 zone)

EMBL: CP001402.PE238

CP001402.PE238       Location/Qualifiers
FT   CDS_pept        complement(204867..205286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0240"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40874"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD3"
FT                   /protein_id="ACR40874.1"
FT                   /translation="MKYEGSISLNATKDQILKLLDNPDQVAQCFPGIKSFTKEGEEYKV
FT                   VGVTGIGFIKGEYKANVRFEKIDENKRKIIAKGTGMNSNVDIDAIAEALDGKINYSADV
FT                   KVAGVLASVGARLMGSALEKIINDLFNCIKERVIK"
     atgaaatatg agggttcaat cagcttaaac gctactaagg atcaaatact caaactactg        60
     gataatccag atcaagtggc acagtgtttt ccaggaataa agagttttac caaggagggt       120
     gaagagtaca aggtagtggg agtaaccggg attggattca taaaaggaga atataaggcg       180
     aatgtgagat ttgagaagat agatgaaaat aagagaaaaa ttattgctaa aggtactgga       240
     atgaatagta acgtggatat agatgcaata gccgaggctc tagatggtaa gataaactat       300
     tcagcagatg tgaaagtagc aggagtttta gcgtctgtag gcgcaagatt aatgggtagt       360
     gcattagaga agatcatcaa tgacttgttc aattgtataa aggagagggt gataaaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page