(data stored in ACNUC7421 zone)

EMBL: CP001402.PE24

CP001402.PE24        Location/Qualifiers
FT   CDS_pept        22073..22735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40660"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE0"
FT                   /protein_id="ACR40660.1"
FT                   /translation="MSWIRDTSFLMECVKNGSIKIEINVSNYSMSFNLLNGKYNLSLFS
FT                   SDNIRISYDGNRLIDMHNLRVLKDHDARVHISNMISNIKGNMSNEINNLAIMYNIPVKI
FT                   LNDNLEAIFNLNFSLLSCLDYGLDYFLIHLTNDFAKQSSQFDVIKKLKLILANEKGCIK
FT                   AILALSNTYESDSFLFSNDCISFQVNVNGFSKFLMDYRTLNAKYTEVIDYLKQRLSQ"
     atgagctgga taagagatac cagttttctt atggagtgtg tcaagaatgg gagcataaag        60
     attgaaatta atgtttctaa ttattccatg tcctttaatc tccttaacgg aaaatataat       120
     ttatcgttat tttcatcaga taatattaga atatcatatg atgggaatag gctaattgat       180
     atgcataact taagagtttt gaaggatcat gatgccagag tacacatttc taatatgatt       240
     agtaatatca agggaaatat gtcaaatgag ataaacaact tggctataat gtataatatt       300
     ccagtgaaaa ttctaaatga taacctagaa gcaatattta atcttaattt ctcattgtta       360
     agctgtttag attacggttt agattatttt ctaattcatt tgactaatga ctttgcaaag       420
     cagtcttctc aatttgatgt aataaagaag ttgaaattga tactagccaa tgaaaaggga       480
     tgtattaagg ctattttagc cttatctaac acctacgaat cggattcttt tttgttttct       540
     aatgattgta taagttttca ggttaacgtg aatggattct ctaaattctt gatggattat       600
     aggacgctca atgcaaaata tacggaagtt atagattatc ttaaacaacg attatctcag       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page