(data stored in ACNUC7421 zone)

EMBL: CP001402.PE240

CP001402.PE240       Location/Qualifiers
FT   CDS_pept        complement(205853..206359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0242"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40876"
FT                   /db_xref="GOA:C4KKD5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD5"
FT                   /protein_id="ACR40876.1"
FT                   /translation="MKVFEKDQKVKVHLKVNGQNYEVETEPRRLLVHVLRELGFTGVHV
FT                   GCDTSNCGACTVIMDGKSVKSCTILAVEADGSEILTIEGLAKDGKLHPIQEAFWEKHGL
FT                   QCGYCTPGMIMEAYWLLKENPNPTEEEIREGISGNLCRCTGYQNIVEAVKLASQKLRME
FT                   IPKAH"
     atgaaagttt ttgagaagga tcaaaaagta aaagttcacc taaaggtaaa tggacaaaat        60
     tatgaagttg aaacagagcc tagaagacta ttagttcacg tacttaggga actaggattt       120
     actggtgttc atgttggttg tgatacaagc aattgtggag catgtactgt aattatggat       180
     ggaaagagcg ttaaatcatg tacaatatta gctgtagagg cagatgggtc agagatttta       240
     acaattgagg ggttagcaaa agatggtaaa ctacacccaa tccaagaagc gttttgggag       300
     aaacatggct tacaatgtgg atattgtact cctggcatga taatggaagc ctattggcta       360
     cttaaggaaa atcctaatcc aacagaggaa gagattaggg aaggaatctc tggtaatttg       420
     tgtagatgta ctggatatca aaatattgtg gaagcagtga aattggcatc tcaaaaatta       480
     aggatggaaa ttcccaaggc gcattaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page