(data stored in ACNUC7421 zone)

EMBL: CP001402.PE243

CP001402.PE243       Location/Qualifiers
FT   CDS_pept        complement(208159..208746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40879"
FT                   /db_xref="GOA:C4KKD8"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD8"
FT                   /protein_id="ACR40879.1"
FT                   /translation="MDLVQIAKYIGFSLLIVSIILYVFVDPVDRLLSYQGPILSGALLG
FT                   WYVLISNTPRDKFIETEGEKIPIVSILIRKRAPLFMAIGSLLIIPWLMPQIYPMVLKIQ
FT                   WLFVLSFLSEFLGGFMIGYIVPSLKFTEKLLLFSLGFAGDTIYLLLLYLASGIFHVPSQ
FT                   LLLNSVIVLVYGIKFPEGVVFAVYIMKKIGGI"
     atggacttag ttcaaattgc caagtatata ggtttttctt tacttatagt ttcaattata        60
     ctttacgttt ttgtagatcc agtggatagg ttactctcgt atcaagggcc aatactctcc       120
     ggtgcactac tggggtggta cgtattaatt tctaacacac caagagataa atttattgaa       180
     actgaaggag aaaaaatacc tattgtttca atattgataa ggaaaagagc gcccttattc       240
     atggccatag gttcgctatt aataatacct tggttaatgc ctcagatata cccaatggta       300
     ttgaagatac agtggctatt cgtactgtct ttcctcagcg aatttctagg gggttttatg       360
     ataggttata tagtaccatc actaaaattt acggaaaagc ttctcttatt tagtctagga       420
     tttgcgggag atacgatata cttgttatta ctatacttag catctggcat attccacgtc       480
     ccatcgcagt tactgttaaa ttcagtaata gtactagttt atggtataaa gtttcctgag       540
     ggcgtagtat ttgcagtcta cattatgaaa aagatagggg gaatttaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page