(data stored in ACNUC7421 zone)

EMBL: CP001402.PE247

CP001402.PE247       Location/Qualifiers
FT   CDS_pept        210965..211744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0249"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40883"
FT                   /db_xref="GOA:C4KKE2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE2"
FT                   /protein_id="ACR40883.1"
FT                   /translation="MIKRLENQQDIWKRIEIVGDIVIIGIPFNKRSEDLIEIANEILLT
FT                   FPYIKSVWGRCRDVSGTYRLSTYVYLAGEKRSETIYKEHKCRYFLDFTKVFFSEKLSYE
FT                   HLRVARQVKRGEIIINMFAGFGPFSILSAVLGKPKVIYSIDANPYAYYYMMVNVELNRA
FT                   YEVLPMYGDAFKRVYDLEDADRIIAPLPELADKAYEVALQKVKKGGTIHLYTEVETNRG
FT                   EDPVGIAMNKYKGSYFGRIVRSVNPHKYHVVVDIKVT"
     ttgataaaaa ggttggaaaa ccagcaagat atatggaaaa ggattgaaat agtaggagat        60
     atagtaatta ttgggatccc ttttaacaaa agatcagaag atcttataga gatagcaaat       120
     gagatacttt taacttttcc ctatattaaa tcagtgtggg gaagatgcag ggacgtctct       180
     ggcacatata ggttatcaac gtatgtatat ttagccggag agaaaagaag tgagaccatt       240
     tataaagagc ataaatgtag atattttctt gattttacta aggtattctt ttctgagaag       300
     ctatcctatg aacatctgag agtagcaaga caagttaaga gaggtgagat tatcataaac       360
     atgttcgctg gttttggccc attttcaatc ctctccgcag ttcttggcaa accaaaagta       420
     atttactcaa tagatgcaaa tccctatgcg tattattata tgatggtaaa cgtagaattg       480
     aatagggctt acgaagtgct tccaatgtat ggagatgctt tcaaaagagt atacgatcta       540
     gaagatgcag atagaataat tgcacctctg ccagaactag cggataaggc atatgaggta       600
     gcgttgcaaa aggtaaaaaa aggtggtaca attcaccttt atactgaggt ggagacgaat       660
     aggggtgagg accccgtagg aattgctatg aataagtata agggatctta ttttggtagg       720
     atagtgagga gtgttaatcc acataagtat catgtggtag ttgatattaa ggttacttag       780
//

If you have problems or comments...

PBIL Back to PBIL home page